Quorumpeps Results


Search hits: 346
ID This field contains the IDs of the molecules listed. If you wish to see more details regarding a molecule, please click its ID. SequenceTrivial nameMolecular formulaSpecies originReceptorReference This field contains the IDs of the related publications for every molecule. If you wish to see more details regarding a related publication, please click its ID.
1Ac-CAFIM, thiolacton linkage between C1 and M5-C28H41N5O6S2DerivedAgrC1, AgrC2, AgrC3, AgrC46
2YSPITNF-NH2RIP, RNAIII Inhibiting PeptideC40H57N9O11DerivedTRAP67
3Ac-CDFIF, thiolacton linkage between C1 and F5-C33H41N5O8SDerivedAgrC6
4Ac-CGGLF, thiolacton linkage between C1 and F5-C24H33N5O6SDerivedAgrC1, AgrC26
5Ac-CGSLF, thiolacton linkage between C1 and F5-C25H35N5O7SDerivedAgrC1, AgrC26
6Ac-CSGLF, thiolacton linkage between C1 and F5-C25H35N5O7SDerivedAgrC1, AgrC26
7YSPWTNF-NH2RIP, RNAIII Inhibiting PeptideC45H56N10O11Staphylococcus aureus, Staphylococcus epidermidisTRAP1, 14, 17, 30, 32
8Ac-NSPNIFGQWM, lacton linkage between S2 and M10 -C56H76N14O15SDerivedFsrC5
9Ac-SPNIFGQWM, lacton linkage between S1 and M9-C52H70N12O13SDerivedFsrC5
10ADLPFEFPapR7IC41H55N7O12Bacillus cereus, Bacillus thuringiensisPlcRI, PlcRII, PlcRIII, PlcRIV3, 37
11AGTKPQGKPASNLVECVFSLFKKCNEntFC118H193N32O34S2Enterococcus faeciumEntK2, 52
13AIFILAScAM373C36H59N7O9Enterococcus faecalis-42
14AITLIFIiCF10C40H67N7O9Enterococcus faecalisPrgX41, 48
15AKDEHPHRBST1C24H38N8O10Bacillus stearothermophilusRap36
16AKTVQphrANTH3C23H43N7O8Bacillus anthracisRap36
17ALILTLVSiPD1C39H72N8O11Enterococcus faecalisTraA41, 42, 46
18ARNQTPhrAC22H40N10O9Bacillus subtilisRapA12, 26
19NNWNNEDF, Extracellular death factorC27H36N10O10Escherichia coli-7
20AVNACSSLF, thiolacton linkage between C5 and F9-C39H60N10O12SDerivedAgrC21
21QNSPNIFGQBal3M, lacton linkage between S3 and M11 -C59H81N15O16S2DerivedFsrC5
22CVGIW, thiolacton linkage between C1 and W5LamDC27H38N6O5S1Lactobacillus plantarumLamC24
23ADPITRQW(Farnesyl)GDComX 168C65H99N15O17Bacillus subtilisComP14, 20, 39
24A(Abu)F(Abu)LPGGGGVA(Abu)L(Abu)(Dha)EAI, cyclisation between (Ala1-S-Abu2), (Abu4-S-Ala12), (Abu13-S-Ala18) and (Ile19-NH-CH=CH-S-Abu15)MersacidinC80H120N20O21S4Bacillus subtilisMrsK222, 69
25CVFSLFKKCN-C54H85N13O13S2DerivedCbaK2, 52
26NSPNIFGQWM, lacton linkage between S2 and M10-C54H74N14O14SDerivedFsrC5
27DICNAYF, thiolacton linkage between C3 and F7AIP, Autoinducing peptideC38H50N8O11SStaphylococcus lugdunensisAgrC14, 56
28DIRHRINNSIWRDIFLKRKCompetence Stimulating Peptide, CSPC111H183N38O27Streptococcus gordonii ComD58, 59
29DKRLPYFFKHLFSNRTKCompetence Stimulating Peptide, CSPC104H157N29O24Streptococcus oralisComD58, 59
30DLRGVPNPWGWIFGRCompetence Stimulating Peptide, CSPC84H120N24O19Streptococcus sanguisComD58, 59
31DLRNIFLKIKFKKKCompetence Stimulating Peptide, CSPC86H148N23O18Streptococcus cristaComD58, 59
32DMCNGYF, thiolacton linkage between C3 and F7AIP, Autoinducing peptideC36H46N8O11S2Staphylococcus lugdunensisAgrC14, 56
33DRRDPRGIIGIGKKLFGCompetence Stimulating Peptide, CSPC84H145N28O22Streptococcus milleriComD59
34DRVGAPhrIC20H36N8O8Bacillus subtilisRap11, 12
35DSACHLGI, thiolacton linkage between C4 and I8AgrD2, AIP, Autoinducing peptideC33H52N10O11S1Clostridium botulinum-25
36DSACVFGA, thiolacton linkage between C4 and A8AgrD2, AIP, Autoinducing peptideC32H46N8O11S1Clostridium sporogenes-25
37DSACVYGF, thiolacton linkage between C4 and F8AgrD2, AIP, Autoinducing peptideC38H50N8O12S1Clostridium botulinum-25
38DSACYVSA, thiolacton linkage between C4 and A8AgrD2, AIP, Autoinducing peptideC33H48N8O13S1Clostridium botulinum-25
39DSACVVGI, thiolacton linkage between C4 and I8AgrD2, AIP, Autoinducing peptideC31H52N8O11S1Clostridium botulinum-25
40DSVCASYF, thiolacton linkage between C4 and F8AIP2, Autoinducing peptide 2C39H52N8O13SStaphylococcus epidermidisAgrC1, AgrC2, AgrC36, 10, 34, 40, 107
41DW(Geranyl)HY-C40H49N7O8DerivedComP14, 20
42CVLVTL, thiolacton linkage between C1 and L6AIP, Autoinducing peptideC29H52N6O7S1Clostridium acetobutylicumAgrC9
43DWRISETIRNLIFPRRKCompetence Stimulating Peptide, CSPC99H163N32O25Streptococcus oralisComD58, 59
44EKMIGPhrGC24H44N6O8SBacillus subtilisRap12, 15
45EMRISRIILDFLFLRKKCompetence Stimulating Peptide, CSPC101H172N28O23S1Streptococcus pneumoniaeComD59, 60
46EMRKSNNNFFHFLRRICompetence Stimulating Peptide, CSPC94H146N31O23S1Streptococcus mitisComD58, 59
47EMRLPKILRDFIFPRKKCompetence Stimulating Peptide, CSPC102H171N29O22S1Streptococcus mitis, Streptococcus pneumoniae, Streptococcus oralisComD58, 71
48EMRLSKFFRDFILQRKKCompetence Stimulating Peptide, CSPC103H168N30O24S1Streptococcus pneumoniaeComD59, 60, 75
49EQLSFTSIGILQLLTIGTRSCWFFYCRYPltAC156H233N37O41S2Lactobacillus plantarumPltK24
50ERGMTCompetence and Sporulation Factor, CSF, PhrCC22H40N8O9SBacillus subtilis, Bacillus mojavensisRapC4, 8, 12
51ERNNTPhr0662C23H40N10O11Bacillus haloduransRap36
52ERPVGPhrKC23H40N8O8Bacillus subtilisRap36
53ESRLPKILLDFLFLRKKCompetence Stimulating Peptide, CSPC101H170N26O23Streptococcus pyogenes, Streptococcus pneumoniaeComD71
54ESRLPKIRFDFIFPRKKCompetence Stimulating Peptide, CSPC103H165N29O23Streptococcus mitisComD58, 59
55ESRVSRIILDFLFQRKKCompetence Stimulating Peptide, CSPC97H163N29O25Streptococcus mitisComD58, 71
56VNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGRRPCarnobacteriocin B2, CB2, CbnB2C213H333N66O68S2Carnobacterium piscicolaCbnK13
57DPITRQW(Farnesyl)GD-C62H94N14O16DerivedComP14, 20
58DSRIRMGFDFSKLFGKCompetence Stimulating Peptide, CSPC86H134N24O23SStreptococcus thermophilus, Streptococcus constellatus, Streptococcus anginosusComD57, 58, 59
59DW(Geranyl)KY-C40H54N6O8DerivedComP14, 20
60EIRQTHNIFFNFFKRRCompetence Stimulating Peptide, CSPC100H150N31O23Streptococcus mitisComD58, 59
61EMRKPDGALFNLFRRRCompetence Stimulating Peptide, CSPC88H145N30O22S1Streptococcus mitisComD58, 59
62ESRISDILLDFLFQRKKCompetence Stimulating Peptide, CSPC96H158N26O27Streptococcus mitisComD58, 71
63GKPASNLVECVFSLFKKCN-C93H151N24O26S2DerivedCbaK, EntK2, 52
64GIFW(Geranyl)EQComX RO-E-2C48H66N8O10Bacillus subtilisComP8
65LDW(Geranyl)KY-C46H65N7O9DerivedComP14, 20
66KCVLVTL, thiolacton linkage between C2 and L7AIP, Autoinducing peptideC35H64N8O8S1DerivedAgrC9
67MDW(Geranyl)HY-C45H58N8O9SDerivedComP14, 20
68Ac-CSSLF, thiolacton linkage between C1 and F5-C26H37N5O8SDerivedAgrC1, AgrC2, AgrC3, AgrC46, 21
69QNSPNIFGQNal1M, lacton linkage between S3 and M11 -C61H83N15O16SDerivedFsrC5
70I(Dhb)AI(Dha)LA(Abu)PGAK(Abu)GALMGANMK(Abu)A(Abu)AHASIHV(Dha)K, cyclisation between (Ala3-S-Ala7), (Abu8-S-Ala11), (Abu13-S-Ala19), (Abu23-S-Ala26) and (Abu25-S-Ala28)Nisin AC143H230N42O37S7Lactococcus lactisNisK13
71QNCPNIFGQWM, thiolacton linkage between C3 and M11 -C59H82N16O15S2DerivedFsrC5
72QNHsePNIFGQWM, lacton linkage between HSr3 and M11 -C56H78N14O14SDerivedFsrC5
74CLGVGSCNDFAGCGYAIVCFW, lactam linkage between C1 and D9, disulfide bond between C1 and C13, disulfide bond between C7 and C19Siamycin IC97H131N23O26S4Streptomyces speciesFsrC6
76SNLVECVFSLFKKCN-C77H124N19O22S2DerivedCbaK2, 52
77VGSRYLCTPGSCWKLVCFTTTVKStreptin 1C114H181N29O31S3Streptococcus pyogenesSrtK70
78WKAE(Dha)LA(Abu)PGAV(Abu)GALQ(Dhb)AFLQ(Abu)L(Abu)ANAKI(Dha)K, cyclisation between (Ala3-S-Ala7), (Abu8-S-Ala11), (Abu13-S-Ala19), (Abu23-S-Ala26) and (Abu25-S-Ala28)SubtilinC148H227N39O38S5Bacillus subtilisSpaK13
79TNGNW(Geranyl)VPS-C48H71N11O13DerivedComP14, 20
80TPGGFDIISGGPHVAQDVLNAIKDFFKIP-TXC131H200N33O38Lactobacillus sakeiStxK2, 55
81YKPITNF-NH2RIP, RNAIII Inhibiting PeptideC43H64N10O10DerivedTRAP67
82YKPITN-NH2RIP, RNAIII Inhibiting PeptideC34H55N9O9DerivedTRAP67
83YSPCTNFF, thiolacton linkage between C4 and F8AIP, Autoinducing peptideC46H57N9O12SStaphylococcus warneri AgrC14, 56
84YSPCTNFFRIP, RNAIII Inhibiting PeptideC46H59N9O13S1DerivedTRAP67
85YSPCTNFRIP, RNAIII Inhibiting PeptideC37H50N8O12S1DerivedTRAP67
86YTNGNW(Geranyl)VPSComX RO-B-2C57H80N12O15Bacillus mojavensisComP14, 20, 39
87FW(Geranyl)E[3–5]ComX RO-E-2C35H44N4O6DerivedComP8
88FW(Geranyl)EQ[3–6]ComX RO-E-2C40H52N6O8DerivedComP8
89GIFW(Geranyl)AQ[E5A]ComX RO-E-2C46H64N8O8DerivedComP8
90AIFW(Geranyl)EQ[G1A]ComX RO-E-2C49H68N8O10DerivedComP8
91AGIFW(Geranyl)EQAla-ComX RO-E-2C51H71N9O11DerivedComP8
92FHWWQTSPAHFSRAP-binding peptide, RBPC75H91N19O17SyntheticTRAP68
93FLVMFLSGcPD1C45H68N8O10SEnterococcus faecalisTraA41, 42, 46
94GAKPCGGFF, thiolacton linkage between C5 and F9AIP, Autoinducing peptideC41H56N10O9SStaphylococcus xylosusAgrC14, 56
95GANPCALYY, thiolacton linkage between C5 and Y9AIP, Autoinducing peptideC44H60N10O12SStaphylococcus capitisAgrC14, 56
96GANPCOLYY, thiolacton linkage between C5 and Y9AIP, Autoinducing peptideC46H65N11O12SStaphylococcus capitisAgrC14, 56
97QNSPNIFGQWM, lacton linkage between S3 and M11 GBAP, Gelatinase Biosynthesis-Activating PheromoneC59H82N16O16SEnterococcus faecalisFsrC5
98GGKVCSAYF, thiolacton linkage between C5 and F9AIP, Autoinducing peptideC42H60N10O11SStaphylococcus cochnii subsp. cochniiAgrC14, 56
99GKAEFphr1988C25H38N6O8Bacillus haloduransRap36
100GKATSSISKCVFSFFKKC-C89H143N22O24S2DerivedCbaK2, 52
101GLWEDILYSLNIIKHNNTKGLHHPIQLBacteriocin Inducing Peptide, BIPC146H228N40O39Streptococcus pneumoniaeBlpH62
102GLWEDLLYNINRYAHYITBacteriocin Inducing Peptide, BIP, BIP-2, BlpCC106H152N26O29Streptococcus pneumoniaeBlpH61, 63
103GNWNNEDF, Extracellular death factorC25H33N9O9Derived-7
105SQKGVYASQRSFVPSWFRKIFRNCompetence Stimulating Peptide, CSPC129H194N38O32Streptococcus gordonii ComD58, 59
106GVAACSSLF, thiolacton linkage between C5 and F9-C37H57N9O11SDerivedAgrC221
107GVNACSSLF, thiolacton linkage between C5 and F9AIP2, Autoinducing peptide 2C38H58N10O12SStaphylococcus aureusAgrC1, AgrC2, AgrC3, AgrC46, 34, 40
108GVNACSSLF, lactam linkage between C5 and F9AIP, Autoinducing peptideC38H58N10O12S1DerivedAgrC1, AgrC466
109GVNASSSLF, lacton linkage between S5 and F9-C38H58N10O13DerivedAgrC, AgrC3, AgrC421
110GVNPCGGWF, thiolacton linkage between C5 and F9AIP, Autoinducing peptideC43H55N11O10SStaphylococcus arlettaeAgrC14, 56
111GKCVLVTL, thiolacton linkage between C3 and L8AIP, Autoinducing peptideC37H67N9O9S1DerivedAgrC9
112GWWEELLHETILSKFKITKALELPIQLBacteriocin Inducing Peptide, BIP-1, BlpCC155H243N35O40Streptococcus pneumoniaeBlpH61
113GYRTCNTYF, thiolacton linkage between C5 and F9AIP, Autoinducing peptideC50H67N13O14SStaphylococcus capraeAgrC14, 56
114GYSTCSYYF, thiolacton linkage between C5 and F9AIP, Autoinducing peptideC51H61N9O15SStaphylococcus capraeAgrC14, 56
115ASTCDFIM, thiolacton linkage between C4 and M8-C37H56N8O12S2DerivedAgrC6
116YATCDFIM, thiolacton linkage between C4 and M8-C43H60N8O12S2DerivedAgrC6
117YSTCAFIM, thiolacton linkage between C4 and M8-C42H60N8O11S2DerivedAgrC1, AgrC2, AgrC3, AgrC46, 21
118YSTCDAIM, thiolacton linkage between C4 and M8-C37H56N8O13S2DerivedAgrC16
119YSTCDFAM, thiolacton linkage between C4 and M8-C40H54N8O13S2DerivedAgrC16
120YSTCSSLF, thiolacton linkage between C4 and F8-C40H56N8O13SDerivedAgrC1, AgrC2, AgrC3, AgrC46
121ILSGAPCIPWPHRCACET4C50H77N11O12SClostridium acetobutylicumRap36
122INCDFLL, thiolacton linkage between C3 and L7AIP3, Autoinducing peptide 3C38H58N8O10SStaphylococcus aureusAgrC1, AgrC2, AgrC3, AgrC46, 34, 40
123IRFVTPhr-pPL10-1, PhrPUMC30H50N8O7Bacillus pumilusRap12, 36
124KAKTCTVLY, thiolacton linkage between C5 and Y9AIP, Autoinducing peptideC46H77N11O12SStaphylococcus auricularisAgrC14, 56
125KSSAYSLQMGATAIKQVKKLFKKWGWPlantaricin A, PlnAC140H223N36O34S1Lactobacillus plantarumPlnB43, 49
126KTKTCTVLY, thiolacton linkage between C5 and Y9AIP, Autoinducing peptideC47H79N11O13SStaphylococcus auricularisAgrC14, 56
127KYNPCANYL, thiolacton linkage between C5 and L9AIP, Autoinducing peptideC49H70N12O13SStaphylococcus epidermidisAgrC14, 56
128KYNPCASYL, thiolacton linkage between C5 and L9AIP, Autoinducing peptideC48H69N11O13SStaphylococcus epidermidisAgrC14, 56
129KYNPCLGFL, thiolacton linkage between C5 and L9AIP, Autoinducing peptideC50H73N11O11SStaphylococcus simulansAgrC14, 56
130KYNPCSNYL, thiolacton linkage between C5 and L9AIP, Autoinducing peptideC49H70N12O14SStaphylococcus epidermidisAgrC, AgrC114, 56, 107
131KYYPCFGYF, thiolacton linkage between C5 and F9AIP, Autoinducing peptideC61H72N10O12SStaphylococcus simulansAgrC14, 56
132LFSLVLAGcAD1C40H66N8O10Enterococcus faecalisTraA41, 42, 44
133LFVVTLVGiAD1C42H70N8O10Enterococcus faecalisTraA41, 42, 44
134LPFEFPapR5IC34H45N5O8Bacillus cereusPlcRI37
135LPFEHPapR5IVC31H43N7O8Bacillus cereusPlcRIV37
137LVTLVFVcCF10C40H67N7O9Enterococcus faecalisPrgX41, 42, 48
138MAGNSSNFIHKIKQIFTHRIP-673C99H157N31O26S1Lactobacillus sakeiSppK16, 51
139NGKCVLVTL, thiolacton linkage between C4 and L9AIP, Autoinducing peptideC41H73N11O11S1DerivedAgrC9
140MKAEHphrANTH1C25H42N8O8SBacillus anthracisRap36
141MLDW(Geranyl)KYComX RO-H-1C51H74N8O10SBacillus mojavensisComP14, 20, 39
142MMDW(Geranyl)HYComX RS-B-1C50H67N9O10S2Bacillus subtilisComP14, 20, 39
143MPFEFPapR5IIC33H43N5O8S1Bacillus cereusPlcRII37
144QASPNIFGQWM, lacton linkage between S3 and M11 -C58H81N15O15SDerivedFsrC5
145Ac-CDFIM, thiolacton linkage between C1 and M5-C29H41N5O8S2DerivedAgrC1, AgrC2, AgrC36, 21
146NEVPFEFPapR7IIIC42H56N8O13Bacillus cereusPlcRI, PlcRII, PlcRIII, PlcRIV37
147NGWNNEDF, Extracellular death factorC25H33N9O9Derived-7
148YSTCDFIM, thiolacton linkage between C4 and M8AIP1, Autoinducing peptide 1C43H60N8O13S2Staphylococcus aureusAgrC1, AgrC2, AgrC36, 34, 40
149YSTCYFIM, thiolacton linkage between C4 and M8AIP4, Autoinducing peptide 4C48H64N8O12S2Staphylococcus aureusAgrC1, AgrC2, AgrC3, AgrC46, 34, 40
150NKSVIKGNPASNLAQCVFSFFKKCPisNC118H189N32O32S2Carnobacterium maltaromaticumPisK2, 53
151NNGNNEDF, Extracellular death factorC18H29N9O10Derived-7
152NNNWNNNEDF, Extracellular death factorC35H48N14O14Derived-7
153NNWGNEDF, Extracellular death factorC25H33N9O9Derived-7
154NNWNGEDF, Extracellular death factorC25H33N9O9Derived-7
155NWNEDF, Extracellular death factorC19H24N6O6Derived-7
156PITNF-NH2RIP, RNAIII Inhibiting PeptideC28H43N7O7DerivedTRAP67
157PWTNF-NH2RIP, RNAIII Inhibiting PeptideC33H42N8O7DerivedTRAP67
158ANSPNIFGQWM, lacton linkage between S3 and M11 -C57H79N15O15SDerivedFsrC5
159AASPNIFGQWM, lacton linkage between S3 and M11 -C56H78N14O14SDerivedFsrC5
160QKGMYPhr-pLS20C27H43N7O8SBacillus subtilisRap12
161QNDprPNIFGQWM, lactam linkage between Dpr3 and M11-C59H83N17O15SDerivedFsrC5
162QRGMIPhrFC24H45N9O7SBacillus subtilisRapF12, 18
163RIPTSTGFF, lacton linkage between S5 and F9AIP, Autoinducing peptideC48H70N12O12DerivedAgrC21
164SDLPFEHPapR7IVC38H53N9O13Bacillus cereusPlcRI, PlcRII, PlcRIII, PlcRIV37
165SDMPFEFPapR7IIC40H53N7O13S1Bacillus cereusPlcRI, PlcRII, PlcRIII, PlcRIV37
166SGSLSTFFLLFNRSFTQALGKCompetence Stimulating Peptide, CSPC108H165N27O30DerivedComD31
167SGSLSTFFRLFLRSFTQALGKCompetence Stimulating Peptide, CSPC110H171N29O29DerivedComD31
169SGSLSTFFRLFNFSFTQALGKCompetence Stimulating Peptide, CSPC111H163N27O30DerivedComD31
171SGSLSTFFRLFNRSFTQA18-CSP, Competence Stimulating PeptideC94H141N26O27Streptococcus mutansComD19
176SGSLSTFFRLFNRSFTQALGK21-CSP, Competence Stimulating PeptideC108H167N30O30Streptococcus mutansComD14, 19, 31
177YSTSDFIM, lacton linkage between S4 and M8-C43H60N8O14SDerivedAgrC21
183SGWMDYINGFLKGFGGQRTLPTKDYNIPQVSTPC156H233N40O44S1Streptococcus thermophilusStbH29
184SIFTLVAiAM373C36H59N7O10Enterococcus faecalis-47
185SINSQIGKATSSISKCVFSFFKKCCbaXC116H189N30O34S2Carnobacterium maltaromaticumCbaK, EntK2, 52
186SKDYNphrANTH2C26H39N7O11Bacillus anthracisRap36
187SKNSQIGKSTSSISKCVFSFFKKCCbnS, CSC116H189N31O35S2Carnobacterium piscicola, Carnobacterium maltaromaticumCbnK64, 65
188SLSTFFRLFNFSFTQALGCompetence Stimulating Peptide, CSPC100H143N23O26DerivedComD31
191SRKATPhr-pTA1040C22H43N9O8Bacillus subtilisRap12
192SRNATPhr-pPOD2000, Phr-pTA1060C20H37N9O9Bacillus subtilisRap12
193SRNVTPhrEC22H41N9O9Bacillus subtilisRapE12, 13, 38
194SSACVWCV, thiolacton linkage between C4 and V8AgrD1, AIP, Autoinducing peptideC36H53N9O10S2Clostridium sporogenes-25
195SSACYWCV, thiolacton linkage between C4 and V8AgrD1, AIP, Autoinducing peptideC40H53N9O11S2Clostridium botulinum-25
197Ac-CSSLF, thiolacton linkage between C1 and F5, S2 is N-methylatedAIP, Autoinducing peptideC27H39N5O8S1DerivedAgrC1, AgrC26
198Ac-CSSLF, thiolacton linkage between C1 and F5, S3 is N-methylatedAIP, Autoinducing peptideC27H39N5O8S1DerivedAgrC1, AgrC26
199Ac-C(5-aminopentanoic acid)LF, thiolacton linkage between C1 and F3AIP, Autoinducing peptideC25H36N4O5S1DerivedAgrC1, AgrC26
200Ac-(2,3-diaminopropanoic acid)SSLF, lactam linkage between (2,3-diaminopropanoic acid) and F4AIP, Autoinducing peptideC26H38N6O8DerivedAgrC1, AgrC26
201(3-sulfanylpropanoic acid)SSLF, thiolacton linkage between (3-sulfanylpropanoic acid) and F4AIP, Autoinducing peptideC24H34N4O7S1DerivedAgrC1, AgrC26
2024-(4-benzylphenoxy)butanoic acid-STCAFIM, thiolacton linkage between C3 and M7AIP, Autoinducing peptideC50H67N7O11S2DerivedAgrC1, AgrC26
2034-(4-benzoylphenoxy)butanoic acid-STCAFIM, thiolacton linkage between C3 and M7AIP, Autoinducing peptideC50H65N7O12S2DerivedAgrC1, AgrC26
204YSTCDFI-CH(-A)-COOH, thiolacton linkage between C4 and COOH-terminusAIP, Autoinducing peptideC43H59N9O15S1DerivedAgrC16
205SVKPCTGFA, thiolacton linkage between C5 and A9AIP, Autoinducing peptideC40H62N10O11SStaphylococcus cochnii subsp. urealyticumAgrC14, 56
206SYPGWSWPHRCACET1C44H51N9O11Clostridium acetobutylicumRap36
207(Obu)AGPAIRAAVKQAQK(Dhb)LKA(Dhb)RLF(Abu)VAAKGKNGAL, cyclisation between (Ala9-S-Ala13), (Abu24-S-Ala27) and (Ala26-S-Ala33)Pep5C153H255N47O39S3Staphylococcus epidermidisLanK72
208TNRNYGKPNKDIGTCIWSGFRHCOrf4C115H176N37O33S2Lactobacillus sakeiSapK2, 54
209TREW(farnesyl)DGComX RO-C-2C47H70N10O12Bacillus mojavensisComP14, 20, 39
210VAVLVLGAcOB1C35H64N8O9Enterococcus faecalis-45
211VGARPCGGFF, thiolacton linkage between C6 and F10AIP, Autoinducing peptideC46H65N13O10SStaphylococcus gallinarumAgrC14, 56
212VPFEFPapR5IIIC33H43N5O8Bacillus cereusPlcRIII37
213QNSPNIFGQFM, lacton linkage between S3 and M11 -C57H81N15O16SDerivedFsrC5
214WPFAHWPWQYPRRAP-binding peptide, RBPC86H103N21O15SyntheticTRAP68
215YKPWTNF-NH2RIP, RNAIII Inhibiting PeptideC48H63N11O10DerivedTRAP67
216YNPCANYL, thiolacton linkage between C4 and L8AIP4, Autoinducing peptide 4C43H58N10O12SStaphylococcus epidermidisAgrC410
217YNPCASYL, thiolacton linkage between C4 and L8AIP1, Autoinducing peptide 1C42H57N9O12SStaphylococcus epidermidisAgrC110
218YNPCSNYL, thiolacton linkage between C4 and L8AIP3, Autoinducing peptide 3C43H58N10O13SStaphylococcus epidermidisAgrC1, AgrC310, 107
219YNPCVGYF, thiolacton linkage between C4 and F8AIP, Autoinducing peptideC46H57N9O11SStaphylococcus carnosusAgrC14, 56
220YNPCLGFI, thiolacton linkage between C4 and I8AIP, Autoinducing peptideC44H61N9O10SStaphylococcus simulansAgrC134
221IFW(Geranyl)EQ[2–6]ComX RO-E-2C46H63N7O9DerivedComP8
222GAFW(Geranyl)EQ[I2A]ComX RO-E-2C45H60N8O10DerivedComP8
223YSTCAbuFIM, thiolacton linkage between C4 and M8-C43H62N8O11S2DerivedAgrC1, AgrC26
224YSTCSYYF, thiolacton linkage between C4 and F8AIP, Autoinducing peptideC49H58N8O14SStaphylococcus capraeAgrC134
225ETIIIIGGG Short Hydrophobic Peptide, SHP1509C39H69N9O13 Streptococcus mutansRgg81
226DILIIVGGShort Hydrophobic Peptide 3, SHP3C37H66N8O11 Streptococcus agalactiaeRgg23, 81
229EGIIVIVVGSHP1358(15-23)C42H75N9O12Streptococcus thermophilusRgg135833
230AILPYFAGCLComS, SHP0316(18-24)C52H78N10O12SStreptococcus thermophilusComR73
231GLDWWSLComSC43H57N9O11Streptococcus mutansComR74
232DIFKLVIDHISMKARKKSilCRC93H160N26O23SStreptococcus dysgalactiaeSilB78, 79
233SAVDWWRLXIPC49H69N13O12Streptococcus pyogenesComR78, 80
234EFDWWNLGXIPC52H63N11O14Streptococcus pyogenesComR78, 80
235DIIIIFPPFGShort Hydrophobic Peptide;SHP1299 C58H86N10O13Streptococcus thermophilusRgg81
236(D)INCDFLL, thiolacton linkage between C3 and L7AIP3 D-I1C38H58N8O10S1DerivedAgrC1, AgrC2, AgrC3, AgrC482
237I(D)NCDFLL, thiolacton linkage between C3 and L7AIP3 D-N2C38H58N8O10SDerivedAgrC1, AgrC2, AgrC3, AgrC482
238RGQQNEBsEDFC27H46N12O12Bacillus subtilis-83
239INEQTVVTKPaEDF-1C44H78N12O16Pseudomonas aeruginosa-83
240VEVSDDGSGGNTSLSQPaEDF-2C60H98N18O30Pseudomonas aeruginosa-83
241APKLSDGAAAGYVTKAPaEDF-3C67H110N18O22Pseudomonas aeruginosa-83
242NFGAPGGAYPWQSP1C55H69N13O14Cryptococcus neoformansTUP184
243APAAEPAPSVKSQNFGAPGGAYPWQSP24 C113H158N28O32Cryptococcus neoformansTUP184
244NFGAPGGASPIQSP2 C44H66N12O14Cryptococcus neoformansTUP184
246GDSVCASYF, thiolacton linkage between C5 and F9-C41H55N9O14SSyntheticAgrC85
247SVCASYF, thiolacton linkage between C3 and F7-C35H47N7O10SSyntheticAgrC85
248SKADT- C20H36N6O10SyntheticCry1Aa94
250DSVSASYF, lacton linkage between S4 and F8- C39H52N8O14SyntheticAgrC85
251DSVDprASYF, lactam linkage between Dpr4 and F8- C39H53N9O13SyntheticAgrC85
252SKPDTNprRBC22H38N6O10Bacillus thuringiensisNpr87
253ARGMT- C20H38N8O7SSynthetic-26
254ERNMT- C24H43N9O10SSynthetic-26
255ERGQT- C22H39N9O10Synthetic-26
256ARNMT- C22H41N9O8SSynthetic-26
258ERNQT- C24H42N10O11Synthetic-26
260AKPDT- C22H38N6O9SyntheticCry1Aa94
261NVWNK- C30H45N9O8Streptococcus pneumoniae-89
262PLWCA- C28H40N6O6SEikenella corodens-89
263NIWNR- C31H47N11O8Streptococcus gordonii -89
264benzyloxycarbonyl-QNSAAAFAAWA, lacton linkage between S3 and A11- C61H79N15O17SyntheticFsr90
265benzyloxycarbonyl-QNSAAAFAQWA, lacton linkage between S3 and A11- C63H82N16O18SyntheticFsr90
266benzyloxycarbonyl-QNSANAFAAWA, lacton linkage between S3 and A11- C62H80N16O18SyntheticFsr90
267benzyloxycarbonyl-QNSAAIFAAWA, lacton linkage between S3 and A11- C64H85N15O17SyntheticFsr90
268benzyloxycarbonyl-QNSPAAFAAWA, lacton linkage between S3 and A11-C63H81N15O17SyntheticFsr90
269benzyloxycarbonyl-QNSAAAFAAWM, lacton linkage between S3 and M11- C63H83N15O17SSyntheticFsr90
270benzyloxycarbonyl-QNSAAAFGAWA, lacton linkage between S3 and A11-C60H77N15O17SyntheticFsr90
271benzyloxycarbonyl-QNSAAAFGAWM, lacton linkage between S3 and M11- C62H81N15O17SSyntheticFsr90
272benzyloxycarbonyl-QNSANAFGAWA, lacton linkage between S3 and A11-C61H78N16O18SyntheticFsr90
273benzyloxycarbonyl-QNSAAAFGQWA, lacton linkage between S3 and A1- C62H80N16O18SyntheticFsr90
274benzyloxycarbonyl-QNSAAIFGAWA, lacton linkage between S3 and A1- C63H83N15O17SyntheticFsr90
275benzyloxycarbonyl-QNSPAAFGAWA, lacton linkage between S3 and A11- C62H79N15O17SyntheticFsr90
276benzyloxycarbonyl-QNSPAAFGAWM, lacton linkage between S3 and M11- C64H83N15O17SSyntheticFsr90
277benzyloxycarbonyl-QNSPAAFGQWA, lacton linkage between S3 and A11- C64H82N16O18SyntheticFsr90
278benzyloxycarbonyl-QNSPNAFGAWA, lacton linkage between S3 and A11-C63H80N16O18SyntheticFsr90
279benzyloxycarbonyl-QNSPAIFGAWA, lacton linkage between S3 and A11-C65H85N15O17SyntheticFsr90
280benzyloxycarbonyl-QNSPNIFGAWA, lacton linkage between S3 and A11- C66H86N16O18SyntheticFsr90
281benzyloxycarbonyl-QNSPAIFGAWM, lacton linkage between S3 and M11-C67H89N15O17SSyntheticFsr90
282benzyloxycarbonyl-QNSPAIFGQWA, lacton linkage between S3 and A11- C67H88N16O18SyntheticFsr90
283benzyloxycarbonyl-QNSPF(pentafluor)IFGAWA, lacton linkage between S3 and A11- C71H84F5N15O17SyntheticFsr90
284benzyloxycarbonyl-QNSPWIFGAWA, lacton linkage between S3 and A11- C73H90N16O17SyntheticFsr90
285benzyloxycarbonyl-QNSPD(Obzl)IFGAWA, lacton linkage between S3 and A11- C73H91N15O19SyntheticFsr90
286benzyloxycarbonyl-QNSPY(2,6-Cl2-Bzl)IFGAWA, lacton linkage between S3 and A11-C78H93Cl2N15O18SyntheticFsr90
287benzyloxycarbonyl-QNSPY(Bzl)IFGAWA, lacton linkage between S3 and A11-C78H95N15O18SyntheticFsr90
288QNSPNIFGQF(D)M, lacton linkage between S3 and M11 -C57H81N15O16SSynthetic-91
289Ac-QNSPNIFGQWM, lacton linkage between S3 and M11-C61H84N16O17SSynthetic-91
290PWASPSAARVFALGRDLPRAGCPLPQPSTM0504 C131H205N39O35SThermotoga maritima-92
291YSTC(alpha-aminobutyric acid)FIM, thiolacton linkage between C4 and M8- C43H62N8O11S2SyntheticAgrC1, AgrC293
292N-4-(4-benzylphenoxy)butyryl-STCAFIM, thiolacton linkage between C4 and M8- C50H67N7O11S2SyntheticAgrC1, AgrC293
293N-4-(4-benzoylphenoxy)butyryl-STCAFIM, thiolacton linkage between C4 and M8- C50H65N7O12S2SyntheticAgrC1, AgrC293
294NASKYNPCSNYL, thiolacton linkage between C8 and L12AIP-II C59H86N16O19SStaphylococcus epidermidisAgrC1, AgrC2, AgrC395
295NAAKYNPCASYL, thiolacton linkage between C8 and L12AIP-III C58H85N15O17SStaphylococcus epidermidisAgrC1, AgrC2, AgrC395
296IMDILIIVGGSHP2-C10 C48H86N10O13SStreptococcus pyogenesRgg96
297MDILIIVGGSHP2-C9C42H75N9O12SStreptococcus pyogenesRgg96
298ILIIVGGSHP2-C7C33H61N7O8Streptococcus pyogenesRgg96
299AMDIIIIVGGSHP3-C10 C45H80N10O13SStreptococcus pyogenesRgg96
300MDIIIIVGGSHP3-C9 C42H75N9O12SStreptococcus pyogenesRgg96
301IIIIVGGSHP3-C7C33H61N7O8Streptococcus pyogenesRgg96
302KW(farnesyl)PPIEComX nattoC53H80N8O9Bacillus subtilisComP97
303WKAE(Dha)VA(Abu)PGAV(Abu)GLLQ(Abu)AFLQ(Abu)I(Abu)ANAKI(Dha)K, cyclisation between (Ala3-S-Ala7), (Abu8-S-Ala11), (Abu13-S-Ala19), (Abu23-S-Ala26) and (Abu25-S-Ala28)EntianinC150H231N39O39S5Bacillus subtilisSpaK98
304CFMFV, thiolacton linkage between C1 and V5AIPC31H41N5O5S2Listeria monocytogenesAgrC99
305SFFIF, lacton linkage between S1 and F5AgrDC36H43N5O6Clostridium thermocellum/100
306LDWWSLGEBS1 XIPC44H59N9O11DerivedComR101
307TGWWMLGEBS2 XIPC41H56N10O9SDerivedComR101
308ETEWWNVGEBS3 XIPC47H61N11O15DerivedComR101
310CLWFT, thiolacton linkage between C1 and T5-C33H42N6O6SDerived/103
312SLWFT, lacton linkage between S1 and T5-C33H42N6O7Derived/103
313TSACLWFT, thiolacton linkage between C4 and T8AgrDCpC43H59N9O11SClostridium perfringens/102, 103
314CLWFTH, thiolacton linkage between C1 and H6-C39H49N9O7SDerived/103
315TYLFTNS, lacton linkage between T1 and S7, modified at T1 and Y2WS9326AC54H68N8O13Clostridium perfringensVirSR104
316TYLFTNS, lacton linkage between T1 and S7, modified at T1WS9326BC54H70N8O13Clostridium perfringensVirSR104
317PFTFAFF, lacton linkage between T3 and F7, modified at P1, F6, F7Cochinmicin II/IIIC46H46ClN7O12Clostridium perfringensVirSR104
318INCAFLL, thiolacton linkage between C3 and L7AIP3 D4AC37H58N8O8SDerivedAgrC1, AgrC2, AgrC3, AgrC482
319IACDFLL, thiolacton linkage between C3 and L7AIP3 N2AC37H57N7O9SDerivedAgrC1, AgrC2, AgrC482
320ANCDFLL, thiolacton linkage between C3 and L7AIP3 I1AC35H52N8O10SDerivedAgrC1, AgrC2, AgrC3, AgrC482
321INCDFL(D)L, thiolacton linkage between C3 and L7AIP3 D-L7C38H58N8O10SDerivedAgrC1, AgrC2, AgrC482
322INDapAFLL, amide linkage between Dap3 and L7AIP3 D4A amideC37H59N9O8DerivedAgrC1, AgrC2, AgrC3, AgrC4105
323Ac-DapAFLL, amide linkage between Dap1 and L5tAIP3 D2A amideC29H44N6O6DerivedAgrC1, AgrC2, AgrC3, AgrC4105
324Ac-CNAYF, thiolacton linkage between C1 and F5-C30H36N6O8SDerivedAgrC1106
325Ac-CNGYF, thiolacton linkage between C1 and F5-C29H34N6O8SDerivedAgrC1106
326Ac-CASYF, thiolacton linkage between C1 and F5-C29H35N5O8SDerivedAgrC1106
327Ac-CN(trityl)AY(tBu)F, thiolacton linkage between C1 and F5-C53H58N6O8SDerivedAgrC1106
328Ac-CN(trityl)GY(tBu)F, thiolacton linkage between C1 and F5-C52H56N6O8SDerivedAgrC1106
329ASVCASYF, thiolacton linkage between C4 and F8-C38H52N8O11SDerivedAgrC1107
330DSACASYF, thiolacton linkage between C4 and F8-C37H48N8O13SDerivedAgrC1107
332D(D)SVCASYF, thiolacton linkage between C4 and F8-C39H52N8O13SDerivedAgrC1107
333DAVCASYF, thiolacton linkage between C4 and F8-C39H52N8O12SDerivedAgrC1107
334DSVCAAYF, thiolacton linkage between C4 and F8-C39H52N8O12SDerivedAgrC1107
335(D)DSVCASYF, thiolacton linkage between C4 and F8-C39H52N8O13SDerivedAgrC1107
336DS(D)VCASYF, thiolacton linkage between C4 and F8-C39H52N8O13SDerivedAgrC1107
337DSVCA(D)SYF, thiolacton linkage between C4 and F8-C39H52N8O13SDerivedAgrC1107
338DSVCASY(D)F, thiolacton linkage between C4 and F8-C39H52N8O13SDerivedAgrC1107
339DSVCYSYF, thiolacton linkage between C4 and F8-C45H56N8O14SDerivedAgrC1107
340DSVCSSYF, thiolacton linkage between C4 and F8-C39H52N8O14SDerivedAgrC1107
341DSACYSYF, thiolacton linkage between C4 and F8-C43H52N8O14SDerivedAgrC1107
342DSACSSYF, thiolacton linkage between C4 and F8-C37H48N8O14SDerivedAgrC1107
343ASVCAAYF , thiolacton linkage between C4 and F8-C38H52N8O10SDerivedAgrC1107
344ASACAAYF, thiolacton linkage between C4 and F8-C36H48N8O10SDerivedAgrC1, AgrC2, AgrC3107
345ASACSAYF, thiolacton linkage between C4 and F8-C36H48N8O11SDerivedAgrC1, AgrC2, AgrC3107
346ASKYNPCSNYL, thiolacton linkage between C7 and L11-C55H80N14O17SDerivedAgrC1107
347SKYNPCSNYL, thiolacton linkage between C6 and L10-C52H75N13O16SDerivedAgrC1107
348NPCSNYL, thiolacton linkage between C3 and L7-C34H49N9O11SDerivedAgrC1107
349Ac-CSNYL, thiolacton linkage between C1 and L5-C27H38N6O9SDerivedAgrC1107