Quorumpeps Results

Quorumpeps^®

Search hits: 350

ID This field contains the IDs of the molecules listed. If you wish to see more details regarding a molecule, please click its ID.	Sequence	Trivial name	Molecular formula	Species origin	Receptor	Reference This field contains the IDs of the related publications for every molecule. If you wish to see more details regarding a related publication, please click its ID.
1	Ac-CAFIM, thiolacton linkage between C1 and M5	-	C28H41N5O6S2	Derived	/, AgrC1, AgrC2, AgrC3, AgrC4	6
2	YSPITNF-NH2	RNAIII Inhibiting Peptide, RIP	C40H57N9O11	Derived	TRAP	67
3	Ac-CDFIF, thiolacton linkage between C1 and F5	-	C33H41N5O8S	Derived	AgrC	6
4	Ac-CGGLF, thiolacton linkage between C1 and F5	-	C24H33N5O6S	Derived	AgrC1, AgrC2	6
5	Ac-CGSLF, thiolacton linkage between C1 and F5	-	C25H35N5O7S	Derived	AgrC1, AgrC2	6
6	Ac-CSGLF, thiolacton linkage between C1 and F5	-	C25H35N5O7S	Derived	AgrC1, AgrC2	6
7	YSPWTNF-NH2	RIP, RNAIII Inhibiting Peptide	C45H56N10O11	Staphylococcus aureus, Staphylococcus epidermidis	TRAP	1, 14, 17, 30, 32
8	Ac-NSPNIFGQWM, lacton linkage between S2 and M10	-	C56H76N14O15S	Derived	FsrC	5
9	Ac-SPNIFGQWM, lacton linkage between S1 and M9	-	C52H70N12O13S	Derived	FsrC	5
10	ADLPFEF	PapR7I	C41H55N7O12	Bacillus thuringiensis, Bacillus cereus	PlcRI, PlcRII, PlcRIII, PlcRIV	3, 37
11	AGTKPQGKPASNLVECVFSLFKKCN	EntF	C118H193N32O34S2	Enterococcus faecium	EntK	2, 52
12	AGTKPQGKPASSISKCVFSFFKKC	-	C115H185N30O31S2	Derived	EntK	2, 52
13	AIFILAS	cAM373	C36H59N7O9	Enterococcus faecalis	-	42
14	AITLIFI	iCF10	C40H67N7O9	Enterococcus faecalis	PrgX	41, 48
15	AKDEH	PHRBST1	C24H38N8O10	Bacillus stearothermophilus	Rap	36
16	AKTVQ	phrANTH3	C23H43N7O8	Bacillus anthracis	Rap	36
17	ALILTLVS	iPD1	C39H72N8O11	Enterococcus faecalis	TraA	41, 42, 46
18	ARNQT	PhrA	C22H40N10O9	Bacillus subtilis	RapA	12, 26
19	NNWNN	EDF, Extracellular death factor	C27H36N10O10	Escherichia coli	-	7
20	AVNACSSLF, thiolacton linkage between C5 and F9	-	C39H60N10O12S	Derived	AgrC	21
21	QNSPNIFGQBal3M, lacton linkage between S3 and M11	-	C59H81N15O16S2	Derived	FsrC	5
22	CVGIW, thiolacton linkage between C1 and W5	LamD	C27H38N6O5S1	Lactobacillus plantarum	LamC	24
23	ADPITRQW(Farnesyl)GD	ComX 168	C65H99N15O17	Bacillus subtilis	ComP	14, 20, 39
24	A(Abu)F(Abu)LPGGGGVA(Abu)L(Abu)(Dha)EAI, cyclisation between (Ala1-S-Abu2), (Abu4-S-Ala12), (Abu13-S-Ala18) and (Ile19-NH-CH=CH-S-Abu15)	Mersacidin	C80H120N20O21S4	Bacillus subtilis	MrsK2	22, 69
25	CVFSLFKKCN	-	C54H85N13O13S2	Derived	CbaK	2, 52
26	NSPNIFGQWM, lacton linkage between S2 and M10	-	C54H74N14O14S	Derived	FsrC	5
27	DICNAYF, thiolacton linkage between C3 and F7	Autoinducing peptide, AIP	C38H50N8O11S	Staphylococcus lugdunensis	AgrC	14, 56
28	DIRHRINNSIWRDIFLKRK	CSP, Competence Stimulating Peptide	C111H183N38O27	Streptococcus gordonii	ComD	58, 59
29	DKRLPYFFKHLFSNRTK	CSP, Competence Stimulating Peptide	C104H157N29O24	Streptococcus oralis	ComD	58, 59
30	DLRGVPNPWGWIFGR	Competence Stimulating Peptide, CSP	C84H120N24O19	Streptococcus sanguis	ComD	58, 59
31	DLRNIFLKIKFKKK	CSP, Competence Stimulating Peptide	C86H148N23O18	Streptococcus crista	ComD	58, 59
32	DMCNGYF, thiolacton linkage between C3 and F7	Autoinducing peptide, AIP	C36H46N8O11S2	Staphylococcus lugdunensis	AgrC	14, 56
33	DRRDPRGIIGIGKKLFG	CSP, Competence Stimulating Peptide	C84H145N28O22	Streptococcus milleri	ComD	59
34	DRVGA	PhrI	C20H36N8O8	Bacillus subtilis	Rap	11, 12
35	DSACHLGI, thiolacton linkage between C4 and I8	Autoinducing peptide, AIP, AgrD2	C33H52N10O11S1	Clostridium botulinum	-	25
36	DSACVFGA, thiolacton linkage between C4 and A8	Autoinducing peptide, AIP, AgrD2	C32H46N8O11S1	Clostridium sporogenes	-	25
37	DSACVYGF, thiolacton linkage between C4 and F8	Autoinducing peptide, AIP, AgrD2	C38H50N8O12S1	Clostridium botulinum	-	25
38	DSACYVSA, thiolacton linkage between C4 and A8	Autoinducing peptide, AIP, AgrD2	C33H48N8O13S1	Clostridium botulinum	-	25
39	DSACVVGI, thiolacton linkage between C4 and I8	AgrD2, Autoinducing peptide, AIP	C31H52N8O11S1	Clostridium botulinum	-	25
40	DSVCASYF, thiolacton linkage between C4 and F8	Autoinducing peptide 2, AIP2	C39H52N8O13S	Staphylococcus epidermidis	AgrC1, AgrC2, AgrC3	6, 10, 34, 40, 107
41	DW(Geranyl)HY	-	C40H49N7O8	Derived	ComP	14, 20
42	CVLVTL, thiolacton linkage between C1 and L6	Autoinducing peptide, AIP	C29H52N6O7S1	Clostridium acetobutylicum	AgrC	9
43	DWRISETIRNLIFPRRK	CSP, Competence Stimulating Peptide	C99H163N32O25	Streptococcus oralis	ComD	58, 59
44	EKMIG	PhrG	C24H44N6O8S	Bacillus subtilis	Rap	12, 15
45	EMRISRIILDFLFLRKK	CSP, Competence Stimulating Peptide	C101H172N28O23S1	Streptococcus pneumoniae	ComD	59, 60
46	EMRKSNNNFFHFLRRI	CSP, Competence Stimulating Peptide	C94H146N31O23S1	Streptococcus mitis	ComD	58, 59
47	EMRLPKILRDFIFPRKK	CSP, Competence Stimulating Peptide	C102H171N29O22S1	Streptococcus oralis, Streptococcus mitis, Streptococcus pneumoniae	ComD	58, 71
48	EMRLSKFFRDFILQRKK	CSP, Competence Stimulating Peptide	C103H168N30O24S1	Streptococcus pneumoniae, Phage-produced	ComD	59, 60, 75
49	EQLSFTSIGILQLLTIGTRSCWFFYCRY	PltA	C156H233N37O41S2	Lactobacillus plantarum	PltK	24
50	ERGMT	PhrC, CSF, Competence and Sporulation Factor	C22H40N8O9S	Bacillus subtilis, Bacillus mojavensis	RapC	4, 8, 12
51	ERNNT	Phr0662	C23H40N10O11	Bacillus halodurans	Rap	36
52	ERPVG	PhrK	C23H40N8O8	Bacillus subtilis	Rap	36
53	ESRLPKILLDFLFLRKK	CSP, Competence Stimulating Peptide	C101H170N26O23	Streptococcus pyogenes, Streptococcus pneumoniae	ComD	71
54	ESRLPKIRFDFIFPRKK	CSP, Competence Stimulating Peptide	C103H165N29O23	Streptococcus mitis	ComD	58, 59
55	ESRVSRIILDFLFQRKK	CSP, Competence Stimulating Peptide	C97H163N29O25	Streptococcus mitis	ComD	58, 71
56	VNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGRRP	CbnB2, CB2, Carnobacteriocin B2	C213H333N66O68S2	Carnobacterium piscicola	CbnK	13
57	DPITRQW(Farnesyl)GD	-	C62H94N14O16	Derived	ComP	14, 20
58	DSRIRMGFDFSKLFGK	CSP, Competence Stimulating Peptide	C86H134N24O23S	Streptococcus anginosus, Streptococcus thermophilus, Streptococcus constellatus	ComD	57, 58, 59
59	DW(Geranyl)KY	-	C40H54N6O8	Derived	ComP	14, 20
60	EIRQTHNIFFNFFKRR	CSP, Competence Stimulating Peptide	C100H150N31O23	Streptococcus mitis	ComD	58, 59
61	EMRKPDGALFNLFRRR	CSP, Competence Stimulating Peptide	C88H145N30O22S1	Streptococcus mitis	ComD	58, 59
62	ESRISDILLDFLFQRKK	CSP, Competence Stimulating Peptide	C96H158N26O27	Streptococcus mitis	ComD	58, 71
63	GKPASNLVECVFSLFKKCN	-	C93H151N24O26S2	Derived	CbaK, EntK	2, 52
64	GIFW(Geranyl)EQ	ComX RO-E-2	C48H66N8O10	Bacillus subtilis	ComP	8
65	LDW(Geranyl)KY	-	C46H65N7O9	Derived	ComP	14, 20
66	KCVLVTL, thiolacton linkage between C2 and L7	Autoinducing peptide, AIP	C35H64N8O8S1	Derived	AgrC	9
67	MDW(Geranyl)HY	-	C45H58N8O9S	Derived	ComP	14, 20
68	Ac-CSSLF, thiolacton linkage between C1 and F5	-	C26H37N5O8S	Derived	AgrC1, AgrC2, AgrC3, AgrC4	6, 21
69	QNSPNIFGQNal1M, lacton linkage between S3 and M11	-	C61H83N15O16S	Derived	FsrC	5
70	I(Dhb)AI(Dha)LA(Abu)PGAK(Abu)GALMGANMK(Abu)A(Abu)AHASIHV(Dha)K, cyclisation between (Ala3-S-Ala7), (Abu8-S-Ala11), (Abu13-S-Ala19), (Abu23-S-Ala26) and (Abu25-S-Ala28)	Nisin A	C143H230N42O37S7	Lactococcus lactis	NisK	13
71	QNCPNIFGQWM, thiolacton linkage between C3 and M11	-	C59H82N16O15S2	Derived	FsrC	5
72	QNHsePNIFGQWM, lacton linkage between HSr3 and M11	-	C56H78N14O14S	Derived	FsrC	5
73	SGSLSTQFRLFNRSFTQALGK	-	C104H166N31O31	Derived	ComD	28
74	CLGVGSCNDFAGCGYAIVCFW, lactam linkage between C1 and D9, disulfide bond between C1 and C13, disulfide bond between C7 and C19	Siamycin I	C97H131N23O26S4	Streptomyces species	FsrC	6
75	SINSQIGKATSNLVECVFSLFKKCN	-	C119H197N32O37S2	Derived	CbaK, EntK	2, 52
76	SNLVECVFSLFKKCN	-	C77H124N19O22S2	Derived	CbaK	2, 52
77	VGSRYLCTPGSCWKLVCFTTTVK	Streptin 1	C114H181N29O31S3	Streptococcus pyogenes	SrtK	70
78	WKAE(Dha)LA(Abu)PGAV(Abu)GALQ(Dhb)AFLQ(Abu)L(Abu)ANAKI(Dha)K, cyclisation between (Ala3-S-Ala7), (Abu8-S-Ala11), (Abu13-S-Ala19), (Abu23-S-Ala26) and (Abu25-S-Ala28)	Subtilin	C148H227N39O38S5	Bacillus subtilis	SpaK	13
79	TNGNW(Geranyl)VPS	-	C48H71N11O13	Derived	ComP	14, 20
80	TPGGFDIISGGPHVAQDVLNAIKDFFK	IP-TX	C131H200N33O38	Lactobacillus sakei	StxK	2, 55
81	YKPITNF-NH2	RNAIII Inhibiting Peptide, RIP	C43H64N10O10	Derived	TRAP	67
82	YKPITN-NH2	RNAIII Inhibiting Peptide, RIP	C34H55N9O9	Derived	TRAP	67
83	YSPCTNFF, thiolacton linkage between C4 and F8	Autoinducing peptide, AIP	C46H57N9O12S	Staphylococcus warneri	AgrC	14, 56
84	YSPCTNFF	RNAIII Inhibiting Peptide, RIP	C46H59N9O13S1	Derived	TRAP	67
85	YSPCTNF	RNAIII Inhibiting Peptide, RIP	C37H50N8O12S1	Derived	TRAP	67
86	YTNGNW(Geranyl)VPS	ComX RO-B-2	C57H80N12O15	Bacillus mojavensis	ComP	14, 20, 39
87	FW(Geranyl)E	[3–5]ComX RO-E-2	C35H44N4O6	Derived	ComP	8
88	FW(Geranyl)EQ	[3–6]ComX RO-E-2	C40H52N6O8	Derived	ComP	8
89	GIFW(Geranyl)AQ	[E5A]ComX RO-E-2	C46H64N8O8	Derived	ComP	8
90	AIFW(Geranyl)EQ	[G1A]ComX RO-E-2	C49H68N8O10	Derived	ComP	8
91	AGIFW(Geranyl)EQ	Ala-ComX RO-E-2	C51H71N9O11	Derived	ComP	8
92	FHWWQTSPAHFS	RBP, RAP-binding peptide	C75H91N19O17	Synthetic	TRAP	68
93	FLVMFLSG	cPD1	C45H68N8O10S	Enterococcus faecalis	TraA	41, 42, 46
94	GAKPCGGFF, thiolacton linkage between C5 and F9	Autoinducing peptide, AIP	C41H56N10O9S	Staphylococcus xylosus	AgrC	14, 56
95	GANPCALYY, thiolacton linkage between C5 and Y9	Autoinducing peptide, AIP	C44H60N10O12S	Staphylococcus capitis	AgrC	14, 56
96	GANPCOLYY, thiolacton linkage between C5 and Y9	Autoinducing peptide, AIP	C46H65N11O12S	Staphylococcus capitis	AgrC	14, 56
97	QNSPNIFGQWM, lacton linkage between S3 and M11	Gelatinase Biosynthesis-Activating Pheromone, GBAP	C59H82N16O16S	Enterococcus faecalis	FsrC	5
98	GGKVCSAYF, thiolacton linkage between C5 and F9	Autoinducing peptide, AIP	C42H60N10O11S	Staphylococcus cochnii subsp. cochnii	AgrC	14, 56
99	GKAEF	phr1988	C25H38N6O8	Bacillus halodurans	Rap	36
100	GKATSSISKCVFSFFKKC	-	C89H143N22O24S2	Derived	CbaK	2, 52
101	GLWEDILYSLNIIKHNNTKGLHHPIQL	BIP, Bacteriocin Inducing Peptide	C146H228N40O39	Streptococcus pneumoniae	BlpH	62
102	GLWEDLLYNINRYAHYIT	BlpC, BIP-2, BIP, Bacteriocin Inducing Peptide	C106H152N26O29	Streptococcus pneumoniae	BlpH	61, 63
103	GNWNN	Extracellular death factor, EDF	C25H33N9O9	Derived	-	7
104	GSLSTFFRLFNRSFTQALGK	TPN1	C105H162N29O28	Derived	ComD	28
105	SQKGVYASQRSFVPSWFRKIFRN	CSP, Competence Stimulating Peptide	C129H194N38O32	Streptococcus gordonii	ComD	58, 59
106	GVAACSSLF, thiolacton linkage between C5 and F9	-	C37H57N9O11S	Derived	AgrC2	21
107	GVNACSSLF, thiolacton linkage between C5 and F9	Autoinducing peptide 2, AIP2	C38H58N10O12S	Staphylococcus aureus	AgrC1, AgrC2, AgrC3, AgrC4	6, 34, 40
108	GVNACSSLF, lactam linkage between C5 and F9	Autoinducing peptide, AIP	C38H58N10O12S1	Derived	AgrC1, AgrC4	66
109	GVNASSSLF, lacton linkage between S5 and F9	-	C38H58N10O13	Derived	AgrC, AgrC3, AgrC4	21
110	GVNPCGGWF, thiolacton linkage between C5 and F9	Autoinducing peptide, AIP	C43H55N11O10S	Staphylococcus arlettae	AgrC	14, 56
111	GKCVLVTL, thiolacton linkage between C3 and L8	AIP, Autoinducing peptide	C37H67N9O9S1	Derived	AgrC	9
112	GWWEELLHETILSKFKITKALELPIQL	BlpC, BIP-1, Bacteriocin Inducing Peptide	C155H243N35O40	Streptococcus pneumoniae	BlpH	61
113	GYRTCNTYF, thiolacton linkage between C5 and F9	Autoinducing peptide, AIP	C50H67N13O14S	Staphylococcus caprae	AgrC	14, 56
114	GYSTCSYYF, thiolacton linkage between C5 and F9	Autoinducing peptide, AIP	C51H61N9O15S	Staphylococcus caprae	AgrC	14, 56
115	ASTCDFIM, thiolacton linkage between C4 and M8	-	C37H56N8O12S2	Derived	AgrC	6
116	YATCDFIM, thiolacton linkage between C4 and M8	-	C43H60N8O12S2	Derived	AgrC	6
117	YSTCAFIM, thiolacton linkage between C4 and M8	-	C42H60N8O11S2	Derived	AgrC1, AgrC2, AgrC3, AgrC4	6, 21
118	YSTCDAIM, thiolacton linkage between C4 and M8	-	C37H56N8O13S2	Derived	AgrC1	6
119	YSTCDFAM, thiolacton linkage between C4 and M8	-	C40H54N8O13S2	Derived	AgrC1	6
120	YSTCSSLF, thiolacton linkage between C4 and F8	-	C40H56N8O13S	Derived	AgrC1, AgrC2, AgrC3, AgrC4	6
121	ILSGAPCIPW	PHRCACET4	C50H77N11O12S	Clostridium acetobutylicum	Rap	36
122	INCDFLL, thiolacton linkage between C3 and L7	Autoinducing peptide 3, AIP3	C38H58N8O10S	Staphylococcus aureus	AgrC1, AgrC2, AgrC3, AgrC4	6, 34, 40
123	IRFVT	PhrPUM, Phr-pPL10-1	C30H50N8O7	Bacillus pumilus	Rap	12, 36
124	KAKTCTVLY, thiolacton linkage between C5 and Y9	Autoinducing peptide, AIP	C46H77N11O12S	Staphylococcus auricularis	AgrC	14, 56
125	KSSAYSLQMGATAIKQVKKLFKKWGW	PlnA, Plantaricin A	C140H223N36O34S1	Lactobacillus plantarum	PlnB	43, 49
126	KTKTCTVLY, thiolacton linkage between C5 and Y9	Autoinducing peptide, AIP	C47H79N11O13S	Staphylococcus auricularis	AgrC	14, 56
127	KYNPCANYL, thiolacton linkage between C5 and L9	Autoinducing peptide, AIP	C49H70N12O13S	Staphylococcus epidermidis	AgrC	14, 56
128	KYNPCASYL, thiolacton linkage between C5 and L9	AIP, Autoinducing peptide	C48H69N11O13S	Staphylococcus epidermidis	AgrC	1, 14, 56
129	KYNPCLGFL, thiolacton linkage between C5 and L9	Autoinducing peptide, AIP	C50H73N11O11S	Staphylococcus simulans	AgrC	14, 56
130	KYNPCSNYL, thiolacton linkage between C5 and L9	Autoinducing peptide, AIP	C49H70N12O14S	Staphylococcus epidermidis	AgrC, AgrC1	14, 56, 107
131	KYYPCFGYF, thiolacton linkage between C5 and F9	Autoinducing peptide, AIP	C61H72N10O12S	Staphylococcus simulans	AgrC	14, 56
132	LFSLVLAG	cAD1	C40H66N8O10	Enterococcus faecalis	TraA	41, 42, 44
133	LFVVTLVG	iAD1	C42H70N8O10	Enterococcus faecalis	TraA	41, 42, 44
134	LPFEF	PapR5I	C34H45N5O8	Bacillus cereus	PlcRI	37
135	LPFEH	PapR5IV	C31H43N7O8	Bacillus cereus	PlcRIV	37
136	LSTFFRLFNRSFTQALGK	TPN3	C100H154N27O25	Derived	ComD	28
137	LVTLVFV	cCF10	C40H67N7O9	Enterococcus faecalis	PrgX	41, 42, 48
138	MAGNSSNFIHKIKQIFTHR	IP-673	C99H157N31O26S1	Lactobacillus sakei	SppK	16, 51
139	NGKCVLVTL, thiolacton linkage between C4 and L9	Autoinducing peptide, AIP	C41H73N11O11S1	Derived	AgrC	9
140	MKAEH	phrANTH1	C25H42N8O8S	Bacillus anthracis	Rap	36
141	MLDW(Geranyl)KY	ComX RO-H-1	C51H74N8O10S	Bacillus mojavensis	ComP	14, 20, 39
142	MMDW(Geranyl)HY	ComX RS-B-1	C50H67N9O10S2	Bacillus subtilis	ComP	14, 20, 39
143	MPFEF	PapR5II	C33H43N5O8S1	Bacillus cereus	PlcRII	37
144	QASPNIFGQWM, lacton linkage between S3 and M11	-	C58H81N15O15S	Derived	FsrC	5
145	Ac-CDFIM, thiolacton linkage between C1 and M5	-	C29H41N5O8S2	Derived	AgrC1, AgrC2, AgrC3	6, 21
146	NEVPFEF	PapR7III	C42H56N8O13	Bacillus cereus	PlcRI, PlcRII, PlcRIII, PlcRIV	37
147	NGWNN	Extracellular death factor, EDF	C25H33N9O9	Derived	-	7
148	YSTCDFIM, thiolacton linkage between C4 and M8	Autoinducing peptide 1, AIP1	C43H60N8O13S2	Staphylococcus aureus	AgrC1, AgrC2, AgrC3	6, 34, 40
149	YSTCYFIM, thiolacton linkage between C4 and M8	Autoinducing peptide 4, AIP4	C48H64N8O12S2	Staphylococcus aureus	AgrC1, AgrC2, AgrC3, AgrC4	6, 34, 40
150	NKSVIKGNPASNLAQCVFSFFKKC	PisN	C118H189N32O32S2	Carnobacterium maltaromaticum	PisK	2, 53
151	NNGNN	Extracellular death factor, EDF	C18H29N9O10	Derived	-	7
152	NNNWNNN	Extracellular death factor, EDF	C35H48N14O14	Derived	-	7
153	NNWGN	Extracellular death factor, EDF	C25H33N9O9	Derived	-	7
154	NNWNG	Extracellular death factor, EDF	C25H33N9O9	Derived	-	7
155	NWN	Extracellular death factor, EDF	C19H24N6O6	Derived	-	7
156	PITNF-NH2	RNAIII Inhibiting Peptide, RIP	C28H43N7O7	Derived	TRAP	67
157	PWTNF-NH2	RNAIII Inhibiting Peptide, RIP	C33H42N8O7	Derived	TRAP	67
158	ANSPNIFGQWM, lacton linkage between S3 and M11	-	C57H79N15O15S	Derived	FsrC	5
159	AASPNIFGQWM, lacton linkage between S3 and M11	-	C56H78N14O14S	Derived	FsrC	5
160	QKGMY	Phr-pLS20	C27H43N7O8S	Bacillus subtilis	Rap	12
161	QNDprPNIFGQWM, lactam linkage between Dpr3 and M11	-	C59H83N17O15S	Derived	FsrC	5
162	QRGMI	PhrF	C24H45N9O7S	Bacillus subtilis	RapF	12, 18
163	RIPTSTGFF, lacton linkage between S5 and F9	Autoinducing peptide, AIP	C48H70N12O12	Derived	AgrC	21
164	SDLPFEH	PapR7IV	C38H53N9O13	Bacillus cereus	PlcRI, PlcRII, PlcRIII, PlcRIV	37
165	SDMPFEF	PapR7II	C40H53N7O13S1	Bacillus cereus	PlcRI, PlcRII, PlcRIII, PlcRIV	37
166	SGSLSTFFLLFNRSFTQALGK	CSP, Competence Stimulating Peptide	C108H165N27O30	Derived	ComD	31
167	SGSLSTFFRLFLRSFTQALGK	CSP, Competence Stimulating Peptide	C110H171N29O29	Derived	ComD	31
168	SGSLSTFFRLFNASFTQALGK	-	C105H160N27O30	Derived	ComD	27
169	SGSLSTFFRLFNFSFTQALGK	Competence Stimulating Peptide, CSP	C111H163N27O30	Derived	ComD	31
170	SGSLSTFFRLFNRSFTQ	TPC4	C91H136N25O26	Derived	ComD	28
171	SGSLSTFFRLFNRSFTQA	Competence Stimulating Peptide, 18-CSP	C94H141N26O27	Streptococcus mutans	ComD	19
172	SGSLSTFFRLFNRSFTQAGK	-	C102H156N29O29	Derived	ComD	27
173	SGSLSTFFRLFNRSFTQAL	TPC2	C100H152N27O28	Derived	ComD	28
174	SGSLSTFFRLFNRSFTQALG	TPC1	C102H155N28O29	Derived	ComD	28
175	SGSLSTFFRLFNRSFTQALGA	-	C105H160N29O30	Derived	ComD	27
176	SGSLSTFFRLFNRSFTQALGK	Competence Stimulating Peptide, 21-CSP	C108H167N30O30	Streptococcus mutans	ComD	14, 19, 31
177	YSTSDFIM, lacton linkage between S4 and M8	-	C43H60N8O14S	Derived	AgrC	21
178	SGSLSTFFRLFNRSFTQALK	-	C106H164N29O29	Derived	ComD	27
179	SGSLSTFFRLFNRSFTQALGV	-	C107H164N29O30	Derived	ComD	27
180	SGSLSTFFRLFNRSQTQALGK	-	C104H166N31O31	Derived	ComD	28
181	SGSLSTFFRLQNRSFTQALGK	-	C104H166N31O31	Derived	ComD	28
182	SGTLSTFFRLFNRSFTQA	TPC3	C95H143N26O27	Derived	ComD	28
183	SGWMDYINGFLKGFGGQRTLPTKDYNIPQV	STP	C156H233N40O44S1	Streptococcus thermophilus	StbH	29
184	SIFTLVA	iAM373	C36H59N7O10	Enterococcus faecalis	-	47
185	SINSQIGKATSSISKCVFSFFKKC	CbaX	C116H189N30O34S2	Carnobacterium maltaromaticum	CbaK, EntK	2, 52
186	SKDYN	phrANTH2	C26H39N7O11	Bacillus anthracis	Rap	36
187	SKNSQIGKSTSSISKCVFSFFKKC	CS, CbnS	C116H189N31O35S2	Carnobacterium piscicola, Carnobacterium maltaromaticum	CbnK	64, 65
188	SLSTFFRLFNFSFTQALG	CSP, Competence Stimulating Peptide	C100H143N23O26	Derived	ComD	31
189	SLSTFFRLFNRSFTQALGK	TPN2	C103H159N28O27	Derived	ComD	28
191	SRKAT	Phr-pTA1040	C22H43N9O8	Bacillus subtilis	Rap	12
192	SRNAT	Phr-pTA1060, Phr-pPOD2000	C20H37N9O9	Bacillus subtilis	Rap	12
193	SRNVT	PhrE	C22H41N9O9	Bacillus subtilis	RapE	12, 13, 38
194	SSACVWCV, thiolacton linkage between C4 and V8	Autoinducing peptide, AIP, AgrD1	C36H53N9O10S2	Clostridium sporogenes	-	25
195	SSACYWCV, thiolacton linkage between C4 and V8	Autoinducing peptide, AIP, AgrD1	C40H53N9O11S2	Clostridium botulinum	-	25
196	STFFRLFNRSFTQALGK	TPN4	C94H143N26O24	Derived	ComD	28
197	Ac-CSSLF, thiolacton linkage between C1 and F5, S2 is N-methylated	Autoinducing peptide, AIP	C27H39N5O8S1	Derived	AgrC1, AgrC2	6
198	Ac-CSSLF, thiolacton linkage between C1 and F5, S3 is N-methylated	AIP, Autoinducing peptide	C27H39N5O8S1	Derived	AgrC1, AgrC2	6
199	Ac-C(5-aminopentanoic acid)LF, thiolacton linkage between C1 and F3	Autoinducing peptide, AIP	C25H36N4O5S1	Derived	AgrC1, AgrC2	6
200	Ac-(2,3-diaminopropanoic acid)SSLF, lactam linkage between (2,3-diaminopropanoic acid) and F4	Autoinducing peptide, AIP	C26H38N6O8	Derived	AgrC1, AgrC2	6
201	(3-sulfanylpropanoic acid)SSLF, thiolacton linkage between (3-sulfanylpropanoic acid) and F4	Autoinducing peptide, AIP	C24H34N4O7S1	Derived	AgrC1, AgrC2	6
202	4-(4-benzylphenoxy)butanoic acid-STCAFIM, thiolacton linkage between C3 and M7	Autoinducing peptide, AIP	C50H67N7O11S2	Derived	AgrC1, AgrC2	6
203	4-(4-benzoylphenoxy)butanoic acid-STCAFIM, thiolacton linkage between C3 and M7	Autoinducing peptide, AIP	C50H65N7O12S2	Derived	AgrC1, AgrC2	6
204	YSTCDFI-CH(-A)-COOH, thiolacton linkage between C4 and COOH-terminus	Autoinducing peptide, AIP	C43H59N9O15S1	Derived	AgrC1	6
205	SVKPCTGFA, thiolacton linkage between C5 and A9	Autoinducing peptide, AIP	C40H62N10O11S	Staphylococcus cochnii subsp. urealyticum	AgrC	14, 56
206	SYPGWSW	PHRCACET1	C44H51N9O11	Clostridium acetobutylicum	Rap	36
207	(Obu)AGPAIRAAVKQAQK(Dhb)LKA(Dhb)RLF(Abu)VAAKGKNGAL, cyclisation between (Ala9-S-Ala13), (Abu24-S-Ala27) and (Ala26-S-Ala33)	Pep5	C153H255N47O39S3	Staphylococcus epidermidis	LanK	72
208	TNRNYGKPNKDIGTCIWSGFRHC	Orf4	C115H176N37O33S2	Lactobacillus sakei	SapK	2, 54
209	TREW(farnesyl)DG	ComX RO-C-2	C47H70N10O12	Bacillus mojavensis	ComP	14, 20, 39
210	VAVLVLGA	cOB1	C35H64N8O9	Enterococcus faecalis	-	45
211	VGARPCGGFF, thiolacton linkage between C6 and F10	AIP, Autoinducing peptide	C46H65N13O10S	Staphylococcus gallinarum	AgrC	14, 56
212	VPFEF	PapR5III	C33H43N5O8	Bacillus cereus	PlcRIII	37
213	QNSPNIFGQFM, lacton linkage between S3 and M11	-	C57H81N15O16S	Derived	FsrC	5
214	WPFAHWPWQYPR	RBP, RAP-binding peptide	C86H103N21O15	Synthetic	TRAP	68
215	YKPWTNF-NH2	RNAIII Inhibiting Peptide, RIP	C48H63N11O10	Derived	TRAP	67
216	YNPCANYL, thiolacton linkage between C4 and L8	Autoinducing peptide 4, AIP4	C43H58N10O12S	Staphylococcus epidermidis	AgrC4	10
217	YNPCASYL, thiolacton linkage between C4 and L8	Autoinducing peptide 1, AIP1	C42H57N9O12S	Staphylococcus epidermidis	AgrC1	10
218	YNPCSNYL, thiolacton linkage between C4 and L8	AIP3, Autoinducing peptide 3	C43H58N10O13S	Staphylococcus epidermidis	AgrC1, AgrC3	10, 107
219	YNPCVGYF, thiolacton linkage between C4 and F8	Autoinducing peptide, AIP	C46H57N9O11S	Staphylococcus carnosus	AgrC	14, 56
220	YNPCLGFI, thiolacton linkage between C4 and I8	Autoinducing peptide, AIP	C44H61N9O10S	Staphylococcus simulans	AgrC1	34
221	IFW(Geranyl)EQ	[2–6]ComX RO-E-2	C46H63N7O9	Derived	ComP	8
222	GAFW(Geranyl)EQ	[I2A]ComX RO-E-2	C45H60N8O10	Derived	ComP	8
223	YSTCAbuFIM, thiolacton linkage between C4 and M8	-	C43H62N8O11S2	Derived	AgrC1, AgrC2	6
224	YSTCSYYF, thiolacton linkage between C4 and F8	Autoinducing peptide, AIP	C49H58N8O14S	Staphylococcus caprae	AgrC1	34
225	ETIIIIGGG	SHP1509, Short Hydrophobic Peptide	C39H69N9O13	Streptococcus mutans	Rgg	81
226	DILIIVGG	SHP3, Short Hydrophobic Peptide 3	C37H66N8O11	Streptococcus agalactiae	Rgg	23, 81
227	DIIIIVGG	SHP2-C8	C37H66N8O11	Derived	Rgg	23
228	EIIIIVGG	-	C38H68N8O11	Derived	Rgg	23
229	EGIIVIVVG	SHP1358(15-23)	C42H75N9O12	Streptococcus thermophilus	Rgg1358	33
230	AILPYFAGCL	SHP0316(18-24), ComS	C52H78N10O12S	Streptococcus thermophilus	ComR	73
231	GLDWWSL	ComS	C43H57N9O11	Streptococcus mutans	ComR	74
232	DIFKLVIDHISMKARKK	SilCR	C93H160N26O23S	Streptococcus dysgalactiae	SilB	78, 79
233	SAVDWWRL	XIP	C49H69N13O12	Streptococcus pyogenes	ComR	78, 80
234	EFDWWNLG	XIP	C52H63N11O14	Streptococcus pyogenes	ComR	78, 80
235	DIIIIFPPFG	Short Hydrophobic Peptide;SHP1299	C58H86N10O13	Streptococcus thermophilus	Rgg	81
236	(D)INCDFLL, thiolacton linkage between C3 and L7	AIP3 D-I1	C38H58N8O10S1	Derived	AgrC1, AgrC2, AgrC3, AgrC4	82
237	I(D)NCDFLL, thiolacton linkage between C3 and L7	AIP3 D-N2	C38H58N8O10S	Derived	AgrC1, AgrC2, AgrC3, AgrC4	82
238	RGQQNE	BsEDF	C27H46N12O12	Bacillus subtilis	-	83
239	INEQTVVTK	PaEDF-1	C44H78N12O16	Pseudomonas aeruginosa	-	83
240	VEVSDDGSGGNTSLSQ	PaEDF-2	C60H98N18O30	Pseudomonas aeruginosa	-	83
241	APKLSDGAAAGYVTKA	PaEDF-3	C67H110N18O22	Pseudomonas aeruginosa	-	83
242	NFGAPGGAYPW	QSP1	C55H69N13O14	Cryptococcus neoformans	TUP1	84
243	APAAEPAPSVKSQNFGAPGGAYPW	QSP24	C113H158N28O32	Cryptococcus neoformans	TUP1	84
244	NFGAPGGASPI	QSP2	C44H66N12O14	Cryptococcus neoformans	TUP1	84
246	GDSVCASYF, thiolacton linkage between C5 and F9	-	C41H55N9O14S	Synthetic	AgrC	85
247	SVCASYF, thiolacton linkage between C3 and F7	-	C35H47N7O10S	Synthetic	AgrC	85
248	SKADT	-	C20H36N6O10	Synthetic	Cry1Aa	94
249	SKPAD	-	C25H38N6O8	Synthetic	Cry1Aa	94
250	DSVSASYF, lacton linkage between S4 and F8	-	C39H52N8O14	Synthetic	AgrC	85
251	DSVDprASYF, lactam linkage between Dpr4 and F8	-	C39H53N9O13	Synthetic	AgrC	85
252	SKPDT	NprRB	C22H38N6O10	Bacillus thuringiensis	Npr	87
253	ARGMT	-	C20H38N8O7S	Synthetic	-	26
254	ERNMT	-	C24H43N9O10S	Synthetic	-	26
255	ERGQT	-	C22H39N9O10	Synthetic	-	26
256	ARNMT	-	C22H41N9O8S	Synthetic	-	26
257	ARGQT	-	C20H37N9O8	Synthetic	-	26
258	ERNQT	-	C24H42N10O11	Synthetic	-	26
259	ERAMT	-	C23H42N8O9S	Synthetic	/	88
260	AKPDT	-	C22H38N6O9	Synthetic	Cry1Aa	94
261	NVWNK	-	C30H45N9O8	Streptococcus pneumoniae	-	89
262	PLWCA	-	C28H40N6O6S	Eikenella corodens	-	89
263	NIWNR	-	C31H47N11O8	Streptococcus gordonii	-	89
264	benzyloxycarbonyl-QNSAAAFAAWA, lacton linkage between S3 and A11	-	C61H79N15O17	Synthetic	Fsr	90
265	benzyloxycarbonyl-QNSAAAFAQWA, lacton linkage between S3 and A11	-	C63H82N16O18	Synthetic	Fsr	90
266	benzyloxycarbonyl-QNSANAFAAWA, lacton linkage between S3 and A11	-	C62H80N16O18	Synthetic	Fsr	90
267	benzyloxycarbonyl-QNSAAIFAAWA, lacton linkage between S3 and A11	-	C64H85N15O17	Synthetic	Fsr	90
268	benzyloxycarbonyl-QNSPAAFAAWA, lacton linkage between S3 and A11	-	C63H81N15O17	Synthetic	Fsr	90
269	benzyloxycarbonyl-QNSAAAFAAWM, lacton linkage between S3 and M11	-	C63H83N15O17S	Synthetic	Fsr	90
270	benzyloxycarbonyl-QNSAAAFGAWA, lacton linkage between S3 and A11	-	C60H77N15O17	Synthetic	Fsr	90
271	benzyloxycarbonyl-QNSAAAFGAWM, lacton linkage between S3 and M11	-	C62H81N15O17S	Synthetic	Fsr	90
272	benzyloxycarbonyl-QNSANAFGAWA, lacton linkage between S3 and A11	-	C61H78N16O18	Synthetic	Fsr	90
273	benzyloxycarbonyl-QNSAAAFGQWA, lacton linkage between S3 and A1	-	C62H80N16O18	Synthetic	Fsr	90
274	benzyloxycarbonyl-QNSAAIFGAWA, lacton linkage between S3 and A1	-	C63H83N15O17	Synthetic	Fsr	90
275	benzyloxycarbonyl-QNSPAAFGAWA, lacton linkage between S3 and A11	-	C62H79N15O17	Synthetic	Fsr	90
276	benzyloxycarbonyl-QNSPAAFGAWM, lacton linkage between S3 and M11	-	C64H83N15O17S	Synthetic	Fsr	90
277	benzyloxycarbonyl-QNSPAAFGQWA, lacton linkage between S3 and A11	-	C64H82N16O18	Synthetic	Fsr	90
278	benzyloxycarbonyl-QNSPNAFGAWA, lacton linkage between S3 and A11	-	C63H80N16O18	Synthetic	Fsr	90
279	benzyloxycarbonyl-QNSPAIFGAWA, lacton linkage between S3 and A11	-	C65H85N15O17	Synthetic	Fsr	90
280	benzyloxycarbonyl-QNSPNIFGAWA, lacton linkage between S3 and A11	-	C66H86N16O18	Synthetic	Fsr	90
281	benzyloxycarbonyl-QNSPAIFGAWM, lacton linkage between S3 and M11	-	C67H89N15O17S	Synthetic	Fsr	90
282	benzyloxycarbonyl-QNSPAIFGQWA, lacton linkage between S3 and A11	-	C67H88N16O18	Synthetic	Fsr	90
283	benzyloxycarbonyl-QNSPF(pentafluor)IFGAWA, lacton linkage between S3 and A11	-	C71H84F5N15O17	Synthetic	Fsr	90
284	benzyloxycarbonyl-QNSPWIFGAWA, lacton linkage between S3 and A11	-	C73H90N16O17	Synthetic	Fsr	90
285	benzyloxycarbonyl-QNSPD(Obzl)IFGAWA, lacton linkage between S3 and A11	-	C73H91N15O19	Synthetic	Fsr	90
286	benzyloxycarbonyl-QNSPY(2,6-Cl2-Bzl)IFGAWA, lacton linkage between S3 and A11	-	C78H93Cl2N15O18	Synthetic	Fsr	90
287	benzyloxycarbonyl-QNSPY(Bzl)IFGAWA, lacton linkage between S3 and A11	-	C78H95N15O18	Synthetic	Fsr	90
288	QNSPNIFGQF(D)M, lacton linkage between S3 and M11	-	C57H81N15O16S	Synthetic	-	91
289	Ac-QNSPNIFGQWM, lacton linkage between S3 and M11	-	C61H84N16O17S	Synthetic	-	91
290	PWASPSAARVFALGRDLPRAGCPLPQPS	TM0504	C131H205N39O35S	Thermotoga maritima	-	92
291	YSTC(alpha-aminobutyric acid)FIM, thiolacton linkage between C4 and M8	-	C43H62N8O11S2	Synthetic	AgrC1, AgrC2	93
292	N-4-(4-benzylphenoxy)butyryl-STCAFIM, thiolacton linkage between C4 and M8	-	C50H67N7O11S2	Synthetic	AgrC1, AgrC2	93
293	N-4-(4-benzoylphenoxy)butyryl-STCAFIM, thiolacton linkage between C4 and M8	-	C50H65N7O12S2	Synthetic	AgrC1, AgrC2	93
294	NASKYNPCSNYL, thiolacton linkage between C8 and L12	AIP-II	C59H86N16O19S	Staphylococcus epidermidis	AgrC1, AgrC2, AgrC3	95
295	NAAKYNPCASYL, thiolacton linkage between C8 and L12	AIP-III	C58H85N15O17S	Staphylococcus epidermidis	AgrC1, AgrC2, AgrC3	95
296	IMDILIIVGG	SHP2-C10	C48H86N10O13S	Streptococcus pyogenes	Rgg	96
297	MDILIIVGG	SHP2-C9	C42H75N9O12S	Streptococcus pyogenes	Rgg	96
298	ILIIVGG	SHP2-C7	C33H61N7O8	Streptococcus pyogenes	Rgg	96
299	AMDIIIIVGG	SHP3-C10	C45H80N10O13S	Streptococcus pyogenes	Rgg	96
300	MDIIIIVGG	SHP3-C9	C42H75N9O12S	Streptococcus pyogenes	Rgg	96
301	IIIIVGG	SHP3-C7	C33H61N7O8	Streptococcus pyogenes	Rgg	96
302	KW(farnesyl)PPIE	ComX _natto	C53H80N8O9	Bacillus subtilis	ComP	97
303	WKAE(Dha)VA(Abu)PGAV(Abu)GLLQ(Abu)AFLQ(Abu)I(Abu)ANAKI(Dha)K, cyclisation between (Ala3-S-Ala7), (Abu8-S-Ala11), (Abu13-S-Ala19), (Abu23-S-Ala26) and (Abu25-S-Ala28)	Entianin	C150H231N39O39S5	Bacillus subtilis	SpaK	98
304	CFMFV, thiolacton linkage between C1 and V5	AIP	C31H41N5O5S2	Listeria monocytogenes	AgrC	99
305	SFFIF, lacton linkage between S1 and F5	AgrD	C36H43N5O6	Clostridium thermocellum	/	100
306	LDWWSLG	EBS1 XIP	C44H59N9O11	Derived	ComR	101
307	TGWWMLG	EBS2 XIP	C41H56N10O9S	Derived	ComR	101
308	ETEWWNVG	EBS3 XIP	C47H61N11O15	Derived	ComR	101
309	CLWFT	-	C33H44N6O7S	Derived	/	103
310	CLWFT, thiolacton linkage between C1 and T5	-	C33H42N6O6S	Derived	/	103
311	SLWFT	-	C33H44N6O8	Derived	/	103
312	SLWFT, lacton linkage between S1 and T5	-	C33H42N6O7	Derived	/	103
313	TSACLWFT, thiolacton linkage between C4 and T8	AgrD_Cp	C43H59N9O11S	Clostridium perfringens	/	102, 103
314	CLWFTH, thiolacton linkage between C1 and H6	-	C39H49N9O7S	Derived	/	103
315	TYLFTNS, lacton linkage between T1 and S7, modified at T1 and Y2	WS9326A	C54H68N8O13	Clostridium perfringens	VirSR	104
316	TYLFTNS, lacton linkage between T1 and S7, modified at T1	WS9326B	C54H70N8O13	Clostridium perfringens	VirSR	104
317	PFTFAFF, lacton linkage between T3 and F7, modified at P1, F6, F7	Cochinmicin II/III	C46H46ClN7O12	Clostridium perfringens	VirSR	104
318	INCAFLL, thiolacton linkage between C3 and L7	AIP3 D4A	C37H58N8O8S	Derived	AgrC1, AgrC2, AgrC3, AgrC4	82
319	IACDFLL, thiolacton linkage between C3 and L7	AIP3 N2A	C37H57N7O9S	Derived	AgrC1, AgrC2, AgrC4	82
320	ANCDFLL, thiolacton linkage between C3 and L7	AIP3 I1A	C35H52N8O10S	Derived	AgrC1, AgrC2, AgrC3, AgrC4	82
321	INCDFL(D)L, thiolacton linkage between C3 and L7	AIP3 D-L7	C38H58N8O10S	Derived	AgrC1, AgrC2, AgrC4	82
322	INDapAFLL, amide linkage between Dap3 and L7	AIP3 D4A amide	C37H59N9O8	Derived	AgrC1, AgrC2, AgrC3, AgrC4	105
323	Ac-DapAFLL, amide linkage between Dap1 and L5	tAIP3 D2A amide	C29H44N6O6	Derived	AgrC1, AgrC2, AgrC3, AgrC4	105
324	Ac-CNAYF, thiolacton linkage between C1 and F5	-	C30H36N6O8S	Derived	AgrC1	106
325	Ac-CNGYF, thiolacton linkage between C1 and F5	-	C29H34N6O8S	Derived	AgrC1	106
326	Ac-CASYF, thiolacton linkage between C1 and F5	-	C29H35N5O8S	Derived	AgrC1	106
327	Ac-CN(trityl)AY(tBu)F, thiolacton linkage between C1 and F5	-	C53H58N6O8S	Derived	AgrC1	106
328	Ac-CN(trityl)GY(tBu)F, thiolacton linkage between C1 and F5	-	C52H56N6O8S	Derived	AgrC1	106
329	ASVCASYF, thiolacton linkage between C4 and F8	-	C38H52N8O11S	Derived	AgrC1	107
330	DSACASYF, thiolacton linkage between C4 and F8	-	C37H48N8O13S	Derived	AgrC1	107
332	D(D)SVCASYF, thiolacton linkage between C4 and F8	-	C39H52N8O13S	Derived	AgrC1	107
333	DAVCASYF, thiolacton linkage between C4 and F8	-	C39H52N8O12S	Derived	AgrC1	107
334	DSVCAAYF, thiolacton linkage between C4 and F8	-	C39H52N8O12S	Derived	AgrC1	107
335	(D)DSVCASYF, thiolacton linkage between C4 and F8	-	C39H52N8O13S	Derived	AgrC1	107
336	DS(D)VCASYF, thiolacton linkage between C4 and F8	-	C39H52N8O13S	Derived	AgrC1	107
337	DSVCA(D)SYF, thiolacton linkage between C4 and F8	-	C39H52N8O13S	Derived	AgrC1	107
338	DSVCASY(D)F, thiolacton linkage between C4 and F8	-	C39H52N8O13S	Derived	AgrC1	107
339	DSVCYSYF, thiolacton linkage between C4 and F8	-	C45H56N8O14S	Derived	AgrC1	107
340	DSVCSSYF, thiolacton linkage between C4 and F8	-	C39H52N8O14S	Derived	AgrC1	107
341	DSACYSYF, thiolacton linkage between C4 and F8	-	C43H52N8O14S	Derived	AgrC1	107
342	DSACSSYF, thiolacton linkage between C4 and F8	-	C37H48N8O14S	Derived	AgrC1	107
343	ASVCAAYF , thiolacton linkage between C4 and F8	-	C38H52N8O10S	Derived	AgrC1	107
344	ASACAAYF, thiolacton linkage between C4 and F8	-	C36H48N8O10S	Derived	AgrC1, AgrC2, AgrC3	107
345	ASACSAYF, thiolacton linkage between C4 and F8	-	C36H48N8O11S	Derived	AgrC1, AgrC2, AgrC3	107
346	ASKYNPCSNYL, thiolacton linkage between C7 and L11	-	C55H80N14O17S	Derived	AgrC1	107
347	SKYNPCSNYL, thiolacton linkage between C6 and L10	-	C52H75N13O16S	Derived	AgrC1	107
348	NPCSNYL, thiolacton linkage between C3 and L7	-	C34H49N9O11S	Derived	AgrC1	107
349	Ac-CSNYL, thiolacton linkage between C1 and L5	-	C27H38N6O9S	Derived	AgrC1	107
350	SAIRGA	Arbitrium	C23H43N9O8	Phage-produced	AimR	108
351	GMPRGA	-	C23H41N9O7S	Derived	AimR	108
352	SNGLDVGKAD	PhrA	C39H66N12O17	Synthetic	TprA	109
353	SKPDIVG	NprX	C31H54N8O11	Bacillus cereus	NprR	110

You are here

Quorumpeps Results

Quorumpeps®

Affiliations

Quorumpeps^®