| 1 | Ac-CAFIM, thiolacton linkage between C1 and M5 | - | C28H41N5O6S2 | Derived | /, AgrC1, AgrC2, AgrC3, AgrC4 | 6 |
| 2 | YSPITNF-NH2 | RNAIII Inhibiting Peptide, RIP | C40H57N9O11 | Derived | TRAP | 67 |
| 3 | Ac-CDFIF, thiolacton linkage between C1 and F5 | - | C33H41N5O8S | Derived | AgrC | 6 |
| 4 | Ac-CGGLF, thiolacton linkage between C1 and F5 | - | C24H33N5O6S | Derived | AgrC1, AgrC2 | 6 |
| 5 | Ac-CGSLF, thiolacton linkage between C1 and F5 | - | C25H35N5O7S | Derived | AgrC1, AgrC2 | 6 |
| 6 | Ac-CSGLF, thiolacton linkage between C1 and F5 | - | C25H35N5O7S | Derived | AgrC1, AgrC2 | 6 |
| 7 | YSPWTNF-NH2 | RIP, RNAIII Inhibiting Peptide | C45H56N10O11 | Staphylococcus aureus, Staphylococcus epidermidis | TRAP | 1, 14, 17, 30, 32 |
| 8 | Ac-NSPNIFGQWM, lacton linkage between S2 and M10 | - | C56H76N14O15S | Derived | FsrC | 5 |
| 9 | Ac-SPNIFGQWM, lacton linkage between S1 and M9 | - | C52H70N12O13S | Derived | FsrC | 5 |
| 10 | ADLPFEF | PapR7I | C41H55N7O12 | Bacillus thuringiensis, Bacillus cereus | PlcRI, PlcRII, PlcRIII, PlcRIV | 3, 37 |
| 11 | AGTKPQGKPASNLVECVFSLFKKCN | EntF | C118H193N32O34S2 | Enterococcus faecium | EntK | 2, 52 |
| 12 | AGTKPQGKPASSISKCVFSFFKKC | - | C115H185N30O31S2 | Derived | EntK | 2, 52 |
| 13 | AIFILAS | cAM373 | C36H59N7O9 | Enterococcus faecalis | - | 42 |
| 14 | AITLIFI | iCF10 | C40H67N7O9 | Enterococcus faecalis | PrgX | 41, 48 |
| 15 | AKDEH | PHRBST1 | C24H38N8O10 | Bacillus stearothermophilus | Rap | 36 |
| 16 | AKTVQ | phrANTH3 | C23H43N7O8 | Bacillus anthracis | Rap | 36 |
| 17 | ALILTLVS | iPD1 | C39H72N8O11 | Enterococcus faecalis | TraA | 41, 42, 46 |
| 18 | ARNQT | PhrA | C22H40N10O9 | Bacillus subtilis | RapA | 12, 26 |
| 19 | NNWNN | EDF, Extracellular death factor | C27H36N10O10 | Escherichia coli | - | 7 |
| 20 | AVNACSSLF, thiolacton linkage between C5 and F9 | - | C39H60N10O12S | Derived | AgrC | 21 |
| 21 | QNSPNIFGQBal3M, lacton linkage between S3 and M11 | - | C59H81N15O16S2 | Derived | FsrC | 5 |
| 22 | CVGIW, thiolacton linkage between C1 and W5 | LamD | C27H38N6O5S1 | Lactobacillus plantarum | LamC | 24 |
| 23 | ADPITRQW(Farnesyl)GD | ComX 168 | C65H99N15O17 | Bacillus subtilis | ComP | 14, 20, 39 |
| 24 | A(Abu)F(Abu)LPGGGGVA(Abu)L(Abu)(Dha)EAI, cyclisation between (Ala1-S-Abu2), (Abu4-S-Ala12), (Abu13-S-Ala18) and (Ile19-NH-CH=CH-S-Abu15) | Mersacidin | C80H120N20O21S4 | Bacillus subtilis | MrsK2 | 22, 69 |
| 25 | CVFSLFKKCN | - | C54H85N13O13S2 | Derived | CbaK | 2, 52 |
| 26 | NSPNIFGQWM, lacton linkage between S2 and M10 | - | C54H74N14O14S | Derived | FsrC | 5 |
| 27 | DICNAYF, thiolacton linkage between C3 and F7 | Autoinducing peptide, AIP | C38H50N8O11S | Staphylococcus lugdunensis | AgrC | 14, 56 |
| 28 | DIRHRINNSIWRDIFLKRK | CSP, Competence Stimulating Peptide | C111H183N38O27 | Streptococcus gordonii | ComD | 58, 59 |
| 29 | DKRLPYFFKHLFSNRTK | CSP, Competence Stimulating Peptide | C104H157N29O24 | Streptococcus oralis | ComD | 58, 59 |
| 30 | DLRGVPNPWGWIFGR | Competence Stimulating Peptide, CSP | C84H120N24O19 | Streptococcus sanguis | ComD | 58, 59 |
| 31 | DLRNIFLKIKFKKK | CSP, Competence Stimulating Peptide | C86H148N23O18 | Streptococcus crista | ComD | 58, 59 |
| 32 | DMCNGYF, thiolacton linkage between C3 and F7 | Autoinducing peptide, AIP | C36H46N8O11S2 | Staphylococcus lugdunensis | AgrC | 14, 56 |
| 33 | DRRDPRGIIGIGKKLFG | CSP, Competence Stimulating Peptide | C84H145N28O22 | Streptococcus milleri | ComD | 59 |
| 34 | DRVGA | PhrI | C20H36N8O8 | Bacillus subtilis | Rap | 11, 12 |
| 35 | DSACHLGI, thiolacton linkage between C4 and I8 | Autoinducing peptide, AIP, AgrD2 | C33H52N10O11S1 | Clostridium botulinum | - | 25 |
| 36 | DSACVFGA, thiolacton linkage between C4 and A8 | Autoinducing peptide, AIP, AgrD2 | C32H46N8O11S1 | Clostridium sporogenes | - | 25 |
| 37 | DSACVYGF, thiolacton linkage between C4 and F8 | Autoinducing peptide, AIP, AgrD2 | C38H50N8O12S1 | Clostridium botulinum | - | 25 |
| 38 | DSACYVSA, thiolacton linkage between C4 and A8 | Autoinducing peptide, AIP, AgrD2 | C33H48N8O13S1 | Clostridium botulinum | - | 25 |
| 39 | DSACVVGI, thiolacton linkage between C4 and I8 | AgrD2, Autoinducing peptide, AIP | C31H52N8O11S1 | Clostridium botulinum | - | 25 |
| 40 | DSVCASYF, thiolacton linkage between C4 and F8 | Autoinducing peptide 2, AIP2 | C39H52N8O13S | Staphylococcus epidermidis | AgrC1, AgrC2, AgrC3 | 6, 10, 34, 40, 107 |
| 41 | DW(Geranyl)HY | - | C40H49N7O8 | Derived | ComP | 14, 20 |
| 42 | CVLVTL, thiolacton linkage between C1 and L6 | Autoinducing peptide, AIP | C29H52N6O7S1 | Clostridium acetobutylicum | AgrC | 9 |
| 43 | DWRISETIRNLIFPRRK | CSP, Competence Stimulating Peptide | C99H163N32O25 | Streptococcus oralis | ComD | 58, 59 |
| 44 | EKMIG | PhrG | C24H44N6O8S | Bacillus subtilis | Rap | 12, 15 |
| 45 | EMRISRIILDFLFLRKK | CSP, Competence Stimulating Peptide | C101H172N28O23S1 | Streptococcus pneumoniae | ComD | 59, 60 |
| 46 | EMRKSNNNFFHFLRRI | CSP, Competence Stimulating Peptide | C94H146N31O23S1 | Streptococcus mitis | ComD | 58, 59 |
| 47 | EMRLPKILRDFIFPRKK | CSP, Competence Stimulating Peptide | C102H171N29O22S1 | Streptococcus oralis, Streptococcus mitis, Streptococcus pneumoniae | ComD | 58, 71 |
| 48 | EMRLSKFFRDFILQRKK | CSP, Competence Stimulating Peptide | C103H168N30O24S1 | Streptococcus pneumoniae, Phage-produced | ComD | 59, 60, 75 |
| 49 | EQLSFTSIGILQLLTIGTRSCWFFYCRY | PltA | C156H233N37O41S2 | Lactobacillus plantarum | PltK | 24 |
| 50 | ERGMT | PhrC, CSF, Competence and Sporulation Factor | C22H40N8O9S | Bacillus subtilis, Bacillus mojavensis | RapC | 4, 8, 12 |
| 51 | ERNNT | Phr0662 | C23H40N10O11 | Bacillus halodurans | Rap | 36 |
| 52 | ERPVG | PhrK | C23H40N8O8 | Bacillus subtilis | Rap | 36 |
| 53 | ESRLPKILLDFLFLRKK | CSP, Competence Stimulating Peptide | C101H170N26O23 | Streptococcus pyogenes, Streptococcus pneumoniae | ComD | 71 |
| 54 | ESRLPKIRFDFIFPRKK | CSP, Competence Stimulating Peptide | C103H165N29O23 | Streptococcus mitis | ComD | 58, 59 |
| 55 | ESRVSRIILDFLFQRKK | CSP, Competence Stimulating Peptide | C97H163N29O25 | Streptococcus mitis | ComD | 58, 71 |
| 56 | VNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGRRP | CbnB2, CB2, Carnobacteriocin B2 | C213H333N66O68S2 | Carnobacterium piscicola | CbnK | 13 |
| 57 | DPITRQW(Farnesyl)GD | - | C62H94N14O16 | Derived | ComP | 14, 20 |
| 58 | DSRIRMGFDFSKLFGK | CSP, Competence Stimulating Peptide | C86H134N24O23S | Streptococcus anginosus, Streptococcus thermophilus, Streptococcus constellatus | ComD | 57, 58, 59 |
| 59 | DW(Geranyl)KY | - | C40H54N6O8 | Derived | ComP | 14, 20 |
| 60 | EIRQTHNIFFNFFKRR | CSP, Competence Stimulating Peptide | C100H150N31O23 | Streptococcus mitis | ComD | 58, 59 |
| 61 | EMRKPDGALFNLFRRR | CSP, Competence Stimulating Peptide | C88H145N30O22S1 | Streptococcus mitis | ComD | 58, 59 |
| 62 | ESRISDILLDFLFQRKK | CSP, Competence Stimulating Peptide | C96H158N26O27 | Streptococcus mitis | ComD | 58, 71 |
| 63 | GKPASNLVECVFSLFKKCN | - | C93H151N24O26S2 | Derived | CbaK, EntK | 2, 52 |
| 64 | GIFW(Geranyl)EQ | ComX RO-E-2 | C48H66N8O10 | Bacillus subtilis | ComP | 8 |
| 65 | LDW(Geranyl)KY | - | C46H65N7O9 | Derived | ComP | 14, 20 |
| 66 | KCVLVTL, thiolacton linkage between C2 and L7 | Autoinducing peptide, AIP | C35H64N8O8S1 | Derived | AgrC | 9 |
| 67 | MDW(Geranyl)HY | - | C45H58N8O9S | Derived | ComP | 14, 20 |
| 68 | Ac-CSSLF, thiolacton linkage between C1 and F5 | - | C26H37N5O8S | Derived | AgrC1, AgrC2, AgrC3, AgrC4 | 6, 21 |
| 69 | QNSPNIFGQNal1M, lacton linkage between S3 and M11 | - | C61H83N15O16S | Derived | FsrC | 5 |
| 70 | I(Dhb)AI(Dha)LA(Abu)PGAK(Abu)GALMGANMK(Abu)A(Abu)AHASIHV(Dha)K, cyclisation between (Ala3-S-Ala7), (Abu8-S-Ala11), (Abu13-S-Ala19), (Abu23-S-Ala26) and (Abu25-S-Ala28) | Nisin A | C143H230N42O37S7 | Lactococcus lactis | NisK | 13 |
| 71 | QNCPNIFGQWM, thiolacton linkage between C3 and M11 | - | C59H82N16O15S2 | Derived | FsrC | 5 |
| 72 | QNHsePNIFGQWM, lacton linkage between HSr3 and M11 | - | C56H78N14O14S | Derived | FsrC | 5 |
| 73 | SGSLSTQFRLFNRSFTQALGK | - | C104H166N31O31 | Derived | ComD | 28 |
| 74 | CLGVGSCNDFAGCGYAIVCFW, lactam linkage between C1 and D9, disulfide bond between C1 and C13, disulfide bond between C7 and C19 | Siamycin I | C97H131N23O26S4 | Streptomyces species | FsrC | 6 |
| 75 | SINSQIGKATSNLVECVFSLFKKCN | - | C119H197N32O37S2 | Derived | CbaK, EntK | 2, 52 |
| 76 | SNLVECVFSLFKKCN | - | C77H124N19O22S2 | Derived | CbaK | 2, 52 |
| 77 | VGSRYLCTPGSCWKLVCFTTTVK | Streptin 1 | C114H181N29O31S3 | Streptococcus pyogenes | SrtK | 70 |
| 78 | WKAE(Dha)LA(Abu)PGAV(Abu)GALQ(Dhb)AFLQ(Abu)L(Abu)ANAKI(Dha)K, cyclisation between (Ala3-S-Ala7), (Abu8-S-Ala11), (Abu13-S-Ala19), (Abu23-S-Ala26) and (Abu25-S-Ala28) | Subtilin | C148H227N39O38S5 | Bacillus subtilis | SpaK | 13 |
| 79 | TNGNW(Geranyl)VPS | - | C48H71N11O13 | Derived | ComP | 14, 20 |
| 80 | TPGGFDIISGGPHVAQDVLNAIKDFFK | IP-TX | C131H200N33O38 | Lactobacillus sakei | StxK | 2, 55 |
| 81 | YKPITNF-NH2 | RNAIII Inhibiting Peptide, RIP | C43H64N10O10 | Derived | TRAP | 67 |
| 82 | YKPITN-NH2 | RNAIII Inhibiting Peptide, RIP | C34H55N9O9 | Derived | TRAP | 67 |
| 83 | YSPCTNFF, thiolacton linkage between C4 and F8 | Autoinducing peptide, AIP | C46H57N9O12S | Staphylococcus warneri | AgrC | 14, 56 |
| 84 | YSPCTNFF | RNAIII Inhibiting Peptide, RIP | C46H59N9O13S1 | Derived | TRAP | 67 |
| 85 | YSPCTNF | RNAIII Inhibiting Peptide, RIP | C37H50N8O12S1 | Derived | TRAP | 67 |
| 86 | YTNGNW(Geranyl)VPS | ComX RO-B-2 | C57H80N12O15 | Bacillus mojavensis | ComP | 14, 20, 39 |
| 87 | FW(Geranyl)E | [3–5]ComX RO-E-2 | C35H44N4O6 | Derived | ComP | 8 |
| 88 | FW(Geranyl)EQ | [3–6]ComX RO-E-2 | C40H52N6O8 | Derived | ComP | 8 |
| 89 | GIFW(Geranyl)AQ | [E5A]ComX RO-E-2 | C46H64N8O8 | Derived | ComP | 8 |
| 90 | AIFW(Geranyl)EQ | [G1A]ComX RO-E-2 | C49H68N8O10 | Derived | ComP | 8 |
| 91 | AGIFW(Geranyl)EQ | Ala-ComX RO-E-2 | C51H71N9O11 | Derived | ComP | 8 |
| 92 | FHWWQTSPAHFS | RBP, RAP-binding peptide | C75H91N19O17 | Synthetic | TRAP | 68 |
| 93 | FLVMFLSG | cPD1 | C45H68N8O10S | Enterococcus faecalis | TraA | 41, 42, 46 |
| 94 | GAKPCGGFF, thiolacton linkage between C5 and F9 | Autoinducing peptide, AIP | C41H56N10O9S | Staphylococcus xylosus | AgrC | 14, 56 |
| 95 | GANPCALYY, thiolacton linkage between C5 and Y9 | Autoinducing peptide, AIP | C44H60N10O12S | Staphylococcus capitis | AgrC | 14, 56 |
| 96 | GANPCOLYY, thiolacton linkage between C5 and Y9 | Autoinducing peptide, AIP | C46H65N11O12S | Staphylococcus capitis | AgrC | 14, 56 |
| 97 | QNSPNIFGQWM, lacton linkage between S3 and M11 | Gelatinase Biosynthesis-Activating Pheromone, GBAP | C59H82N16O16S | Enterococcus faecalis | FsrC | 5 |
| 98 | GGKVCSAYF, thiolacton linkage between C5 and F9 | Autoinducing peptide, AIP | C42H60N10O11S | Staphylococcus cochnii subsp. cochnii | AgrC | 14, 56 |
| 99 | GKAEF | phr1988 | C25H38N6O8 | Bacillus halodurans | Rap | 36 |
| 100 | GKATSSISKCVFSFFKKC | - | C89H143N22O24S2 | Derived | CbaK | 2, 52 |
| 101 | GLWEDILYSLNIIKHNNTKGLHHPIQL | BIP, Bacteriocin Inducing Peptide | C146H228N40O39 | Streptococcus pneumoniae | BlpH | 62 |
| 102 | GLWEDLLYNINRYAHYIT | BlpC, BIP-2, BIP, Bacteriocin Inducing Peptide | C106H152N26O29 | Streptococcus pneumoniae | BlpH | 61, 63 |
| 103 | GNWNN | Extracellular death factor, EDF | C25H33N9O9 | Derived | - | 7 |
| 104 | GSLSTFFRLFNRSFTQALGK | TPN1 | C105H162N29O28 | Derived | ComD | 28 |
| 105 | SQKGVYASQRSFVPSWFRKIFRN | CSP, Competence Stimulating Peptide | C129H194N38O32 | Streptococcus gordonii | ComD | 58, 59 |
| 106 | GVAACSSLF, thiolacton linkage between C5 and F9 | - | C37H57N9O11S | Derived | AgrC2 | 21 |
| 107 | GVNACSSLF, thiolacton linkage between C5 and F9 | Autoinducing peptide 2, AIP2 | C38H58N10O12S | Staphylococcus aureus | AgrC1, AgrC2, AgrC3, AgrC4 | 6, 34, 40 |
| 108 | GVNACSSLF, lactam linkage between C5 and F9 | Autoinducing peptide, AIP | C38H58N10O12S1 | Derived | AgrC1, AgrC4 | 66 |
| 109 | GVNASSSLF, lacton linkage between S5 and F9 | - | C38H58N10O13 | Derived | AgrC, AgrC3, AgrC4 | 21 |
| 110 | GVNPCGGWF, thiolacton linkage between C5 and F9 | Autoinducing peptide, AIP | C43H55N11O10S | Staphylococcus arlettae | AgrC | 14, 56 |
| 111 | GKCVLVTL, thiolacton linkage between C3 and L8 | AIP, Autoinducing peptide | C37H67N9O9S1 | Derived | AgrC | 9 |
| 112 | GWWEELLHETILSKFKITKALELPIQL | BlpC, BIP-1, Bacteriocin Inducing Peptide | C155H243N35O40 | Streptococcus pneumoniae | BlpH | 61 |
| 113 | GYRTCNTYF, thiolacton linkage between C5 and F9 | Autoinducing peptide, AIP | C50H67N13O14S | Staphylococcus caprae | AgrC | 14, 56 |
| 114 | GYSTCSYYF, thiolacton linkage between C5 and F9 | Autoinducing peptide, AIP | C51H61N9O15S | Staphylococcus caprae | AgrC | 14, 56 |
| 115 | ASTCDFIM, thiolacton linkage between C4 and M8 | - | C37H56N8O12S2 | Derived | AgrC | 6 |
| 116 | YATCDFIM, thiolacton linkage between C4 and M8 | - | C43H60N8O12S2 | Derived | AgrC | 6 |
| 117 | YSTCAFIM, thiolacton linkage between C4 and M8 | - | C42H60N8O11S2 | Derived | AgrC1, AgrC2, AgrC3, AgrC4 | 6, 21 |
| 118 | YSTCDAIM, thiolacton linkage between C4 and M8 | - | C37H56N8O13S2 | Derived | AgrC1 | 6 |
| 119 | YSTCDFAM, thiolacton linkage between C4 and M8 | - | C40H54N8O13S2 | Derived | AgrC1 | 6 |
| 120 | YSTCSSLF, thiolacton linkage between C4 and F8 | - | C40H56N8O13S | Derived | AgrC1, AgrC2, AgrC3, AgrC4 | 6 |
| 121 | ILSGAPCIPW | PHRCACET4 | C50H77N11O12S | Clostridium acetobutylicum | Rap | 36 |
| 122 | INCDFLL, thiolacton linkage between C3 and L7 | Autoinducing peptide 3, AIP3 | C38H58N8O10S | Staphylococcus aureus | AgrC1, AgrC2, AgrC3, AgrC4 | 6, 34, 40 |
| 123 | IRFVT | PhrPUM, Phr-pPL10-1 | C30H50N8O7 | Bacillus pumilus | Rap | 12, 36 |
| 124 | KAKTCTVLY, thiolacton linkage between C5 and Y9 | Autoinducing peptide, AIP | C46H77N11O12S | Staphylococcus auricularis | AgrC | 14, 56 |
| 125 | KSSAYSLQMGATAIKQVKKLFKKWGW | PlnA, Plantaricin A | C140H223N36O34S1 | Lactobacillus plantarum | PlnB | 43, 49 |
| 126 | KTKTCTVLY, thiolacton linkage between C5 and Y9 | Autoinducing peptide, AIP | C47H79N11O13S | Staphylococcus auricularis | AgrC | 14, 56 |
| 127 | KYNPCANYL, thiolacton linkage between C5 and L9 | Autoinducing peptide, AIP | C49H70N12O13S | Staphylococcus epidermidis | AgrC | 14, 56 |
| 128 | KYNPCASYL, thiolacton linkage between C5 and L9 | AIP, Autoinducing peptide | C48H69N11O13S | Staphylococcus epidermidis | AgrC | 1, 14, 56 |
| 129 | KYNPCLGFL, thiolacton linkage between C5 and L9 | Autoinducing peptide, AIP | C50H73N11O11S | Staphylococcus simulans | AgrC | 14, 56 |
| 130 | KYNPCSNYL, thiolacton linkage between C5 and L9 | Autoinducing peptide, AIP | C49H70N12O14S | Staphylococcus epidermidis | AgrC, AgrC1 | 14, 56, 107 |
| 131 | KYYPCFGYF, thiolacton linkage between C5 and F9 | Autoinducing peptide, AIP | C61H72N10O12S | Staphylococcus simulans | AgrC | 14, 56 |
| 132 | LFSLVLAG | cAD1 | C40H66N8O10 | Enterococcus faecalis | TraA | 41, 42, 44 |
| 133 | LFVVTLVG | iAD1 | C42H70N8O10 | Enterococcus faecalis | TraA | 41, 42, 44 |
| 134 | LPFEF | PapR5I | C34H45N5O8 | Bacillus cereus | PlcRI | 37 |
| 135 | LPFEH | PapR5IV | C31H43N7O8 | Bacillus cereus | PlcRIV | 37 |
| 136 | LSTFFRLFNRSFTQALGK | TPN3 | C100H154N27O25 | Derived | ComD | 28 |
| 137 | LVTLVFV | cCF10 | C40H67N7O9 | Enterococcus faecalis | PrgX | 41, 42, 48 |
| 138 | MAGNSSNFIHKIKQIFTHR | IP-673 | C99H157N31O26S1 | Lactobacillus sakei | SppK | 16, 51 |
| 139 | NGKCVLVTL, thiolacton linkage between C4 and L9 | Autoinducing peptide, AIP | C41H73N11O11S1 | Derived | AgrC | 9 |
| 140 | MKAEH | phrANTH1 | C25H42N8O8S | Bacillus anthracis | Rap | 36 |
| 141 | MLDW(Geranyl)KY | ComX RO-H-1 | C51H74N8O10S | Bacillus mojavensis | ComP | 14, 20, 39 |
| 142 | MMDW(Geranyl)HY | ComX RS-B-1 | C50H67N9O10S2 | Bacillus subtilis | ComP | 14, 20, 39 |
| 143 | MPFEF | PapR5II | C33H43N5O8S1 | Bacillus cereus | PlcRII | 37 |
| 144 | QASPNIFGQWM, lacton linkage between S3 and M11 | - | C58H81N15O15S | Derived | FsrC | 5 |
| 145 | Ac-CDFIM, thiolacton linkage between C1 and M5 | - | C29H41N5O8S2 | Derived | AgrC1, AgrC2, AgrC3 | 6, 21 |
| 146 | NEVPFEF | PapR7III | C42H56N8O13 | Bacillus cereus | PlcRI, PlcRII, PlcRIII, PlcRIV | 37 |
| 147 | NGWNN | Extracellular death factor, EDF | C25H33N9O9 | Derived | - | 7 |
| 148 | YSTCDFIM, thiolacton linkage between C4 and M8 | Autoinducing peptide 1, AIP1 | C43H60N8O13S2 | Staphylococcus aureus | AgrC1, AgrC2, AgrC3 | 6, 34, 40 |
| 149 | YSTCYFIM, thiolacton linkage between C4 and M8 | Autoinducing peptide 4, AIP4 | C48H64N8O12S2 | Staphylococcus aureus | AgrC1, AgrC2, AgrC3, AgrC4 | 6, 34, 40 |
| 150 | NKSVIKGNPASNLAQCVFSFFKKC | PisN | C118H189N32O32S2 | Carnobacterium maltaromaticum | PisK | 2, 53 |
| 151 | NNGNN | Extracellular death factor, EDF | C18H29N9O10 | Derived | - | 7 |
| 152 | NNNWNNN | Extracellular death factor, EDF | C35H48N14O14 | Derived | - | 7 |
| 153 | NNWGN | Extracellular death factor, EDF | C25H33N9O9 | Derived | - | 7 |
| 154 | NNWNG | Extracellular death factor, EDF | C25H33N9O9 | Derived | - | 7 |
| 155 | NWN | Extracellular death factor, EDF | C19H24N6O6 | Derived | - | 7 |
| 156 | PITNF-NH2 | RNAIII Inhibiting Peptide, RIP | C28H43N7O7 | Derived | TRAP | 67 |
| 157 | PWTNF-NH2 | RNAIII Inhibiting Peptide, RIP | C33H42N8O7 | Derived | TRAP | 67 |
| 158 | ANSPNIFGQWM, lacton linkage between S3 and M11 | - | C57H79N15O15S | Derived | FsrC | 5 |
| 159 | AASPNIFGQWM, lacton linkage between S3 and M11 | - | C56H78N14O14S | Derived | FsrC | 5 |
| 160 | QKGMY | Phr-pLS20 | C27H43N7O8S | Bacillus subtilis | Rap | 12 |
| 161 | QNDprPNIFGQWM, lactam linkage between Dpr3 and M11 | - | C59H83N17O15S | Derived | FsrC | 5 |
| 162 | QRGMI | PhrF | C24H45N9O7S | Bacillus subtilis | RapF | 12, 18 |
| 163 | RIPTSTGFF, lacton linkage between S5 and F9 | Autoinducing peptide, AIP | C48H70N12O12 | Derived | AgrC | 21 |
| 164 | SDLPFEH | PapR7IV | C38H53N9O13 | Bacillus cereus | PlcRI, PlcRII, PlcRIII, PlcRIV | 37 |
| 165 | SDMPFEF | PapR7II | C40H53N7O13S1 | Bacillus cereus | PlcRI, PlcRII, PlcRIII, PlcRIV | 37 |
| 166 | SGSLSTFFLLFNRSFTQALGK | CSP, Competence Stimulating Peptide | C108H165N27O30 | Derived | ComD | 31 |
| 167 | SGSLSTFFRLFLRSFTQALGK | CSP, Competence Stimulating Peptide | C110H171N29O29 | Derived | ComD | 31 |
| 168 | SGSLSTFFRLFNASFTQALGK | - | C105H160N27O30 | Derived | ComD | 27 |
| 169 | SGSLSTFFRLFNFSFTQALGK | Competence Stimulating Peptide, CSP | C111H163N27O30 | Derived | ComD | 31 |
| 170 | SGSLSTFFRLFNRSFTQ | TPC4 | C91H136N25O26 | Derived | ComD | 28 |
| 171 | SGSLSTFFRLFNRSFTQA | Competence Stimulating Peptide, 18-CSP | C94H141N26O27 | Streptococcus mutans | ComD | 19 |
| 172 | SGSLSTFFRLFNRSFTQAGK | - | C102H156N29O29 | Derived | ComD | 27 |
| 173 | SGSLSTFFRLFNRSFTQAL | TPC2 | C100H152N27O28 | Derived | ComD | 28 |
| 174 | SGSLSTFFRLFNRSFTQALG | TPC1 | C102H155N28O29 | Derived | ComD | 28 |
| 175 | SGSLSTFFRLFNRSFTQALGA | - | C105H160N29O30 | Derived | ComD | 27 |
| 176 | SGSLSTFFRLFNRSFTQALGK | Competence Stimulating Peptide, 21-CSP | C108H167N30O30 | Streptococcus mutans | ComD | 14, 19, 31 |
| 177 | YSTSDFIM, lacton linkage between S4 and M8 | - | C43H60N8O14S | Derived | AgrC | 21 |
| 178 | SGSLSTFFRLFNRSFTQALK | - | C106H164N29O29 | Derived | ComD | 27 |
| 179 | SGSLSTFFRLFNRSFTQALGV | - | C107H164N29O30 | Derived | ComD | 27 |
| 180 | SGSLSTFFRLFNRSQTQALGK | - | C104H166N31O31 | Derived | ComD | 28 |
| 181 | SGSLSTFFRLQNRSFTQALGK | - | C104H166N31O31 | Derived | ComD | 28 |
| 182 | SGTLSTFFRLFNRSFTQA | TPC3 | C95H143N26O27 | Derived | ComD | 28 |
| 183 | SGWMDYINGFLKGFGGQRTLPTKDYNIPQV | STP | C156H233N40O44S1 | Streptococcus thermophilus | StbH | 29 |
| 184 | SIFTLVA | iAM373 | C36H59N7O10 | Enterococcus faecalis | - | 47 |
| 185 | SINSQIGKATSSISKCVFSFFKKC | CbaX | C116H189N30O34S2 | Carnobacterium maltaromaticum | CbaK, EntK | 2, 52 |
| 186 | SKDYN | phrANTH2 | C26H39N7O11 | Bacillus anthracis | Rap | 36 |
| 187 | SKNSQIGKSTSSISKCVFSFFKKC | CS, CbnS | C116H189N31O35S2 | Carnobacterium piscicola, Carnobacterium maltaromaticum | CbnK | 64, 65 |
| 188 | SLSTFFRLFNFSFTQALG | CSP, Competence Stimulating Peptide | C100H143N23O26 | Derived | ComD | 31 |
| 189 | SLSTFFRLFNRSFTQALGK | TPN2 | C103H159N28O27 | Derived | ComD | 28 |
| 191 | SRKAT | Phr-pTA1040 | C22H43N9O8 | Bacillus subtilis | Rap | 12 |
| 192 | SRNAT | Phr-pTA1060, Phr-pPOD2000 | C20H37N9O9 | Bacillus subtilis | Rap | 12 |
| 193 | SRNVT | PhrE | C22H41N9O9 | Bacillus subtilis | RapE | 12, 13, 38 |
| 194 | SSACVWCV, thiolacton linkage between C4 and V8 | Autoinducing peptide, AIP, AgrD1 | C36H53N9O10S2 | Clostridium sporogenes | - | 25 |
| 195 | SSACYWCV, thiolacton linkage between C4 and V8 | Autoinducing peptide, AIP, AgrD1 | C40H53N9O11S2 | Clostridium botulinum | - | 25 |
| 196 | STFFRLFNRSFTQALGK | TPN4 | C94H143N26O24 | Derived | ComD | 28 |
| 197 | Ac-CSSLF, thiolacton linkage between C1 and F5, S2 is N-methylated | Autoinducing peptide, AIP | C27H39N5O8S1 | Derived | AgrC1, AgrC2 | 6 |
| 198 | Ac-CSSLF, thiolacton linkage between C1 and F5, S3 is N-methylated | AIP, Autoinducing peptide | C27H39N5O8S1 | Derived | AgrC1, AgrC2 | 6 |
| 199 | Ac-C(5-aminopentanoic acid)LF, thiolacton linkage between C1 and F3 | Autoinducing peptide, AIP | C25H36N4O5S1 | Derived | AgrC1, AgrC2 | 6 |
| 200 | Ac-(2,3-diaminopropanoic acid)SSLF, lactam linkage between (2,3-diaminopropanoic acid) and F4 | Autoinducing peptide, AIP | C26H38N6O8 | Derived | AgrC1, AgrC2 | 6 |
| 201 | (3-sulfanylpropanoic acid)SSLF, thiolacton linkage between (3-sulfanylpropanoic acid) and F4 | Autoinducing peptide, AIP | C24H34N4O7S1 | Derived | AgrC1, AgrC2 | 6 |
| 202 | 4-(4-benzylphenoxy)butanoic acid-STCAFIM, thiolacton linkage between C3 and M7 | Autoinducing peptide, AIP | C50H67N7O11S2 | Derived | AgrC1, AgrC2 | 6 |
| 203 | 4-(4-benzoylphenoxy)butanoic acid-STCAFIM, thiolacton linkage between C3 and M7 | Autoinducing peptide, AIP | C50H65N7O12S2 | Derived | AgrC1, AgrC2 | 6 |
| 204 | YSTCDFI-CH(-A)-COOH, thiolacton linkage between C4 and COOH-terminus | Autoinducing peptide, AIP | C43H59N9O15S1 | Derived | AgrC1 | 6 |
| 205 | SVKPCTGFA, thiolacton linkage between C5 and A9 | Autoinducing peptide, AIP | C40H62N10O11S | Staphylococcus cochnii subsp. urealyticum | AgrC | 14, 56 |
| 206 | SYPGWSW | PHRCACET1 | C44H51N9O11 | Clostridium acetobutylicum | Rap | 36 |
| 207 | (Obu)AGPAIRAAVKQAQK(Dhb)LKA(Dhb)RLF(Abu)VAAKGKNGAL, cyclisation between (Ala9-S-Ala13), (Abu24-S-Ala27) and (Ala26-S-Ala33) | Pep5 | C153H255N47O39S3 | Staphylococcus epidermidis | LanK | 72 |
| 208 | TNRNYGKPNKDIGTCIWSGFRHC | Orf4 | C115H176N37O33S2 | Lactobacillus sakei | SapK | 2, 54 |
| 209 | TREW(farnesyl)DG | ComX RO-C-2 | C47H70N10O12 | Bacillus mojavensis | ComP | 14, 20, 39 |
| 210 | VAVLVLGA | cOB1 | C35H64N8O9 | Enterococcus faecalis | - | 45 |
| 211 | VGARPCGGFF, thiolacton linkage between C6 and F10 | AIP, Autoinducing peptide | C46H65N13O10S | Staphylococcus gallinarum | AgrC | 14, 56 |
| 212 | VPFEF | PapR5III | C33H43N5O8 | Bacillus cereus | PlcRIII | 37 |
| 213 | QNSPNIFGQFM, lacton linkage between S3 and M11 | - | C57H81N15O16S | Derived | FsrC | 5 |
| 214 | WPFAHWPWQYPR | RBP, RAP-binding peptide | C86H103N21O15 | Synthetic | TRAP | 68 |
| 215 | YKPWTNF-NH2 | RNAIII Inhibiting Peptide, RIP | C48H63N11O10 | Derived | TRAP | 67 |
| 216 | YNPCANYL, thiolacton linkage between C4 and L8 | Autoinducing peptide 4, AIP4 | C43H58N10O12S | Staphylococcus epidermidis | AgrC4 | 10 |
| 217 | YNPCASYL, thiolacton linkage between C4 and L8 | Autoinducing peptide 1, AIP1 | C42H57N9O12S | Staphylococcus epidermidis | AgrC1 | 10 |
| 218 | YNPCSNYL, thiolacton linkage between C4 and L8 | AIP3, Autoinducing peptide 3 | C43H58N10O13S | Staphylococcus epidermidis | AgrC1, AgrC3 | 10, 107 |
| 219 | YNPCVGYF, thiolacton linkage between C4 and F8 | Autoinducing peptide, AIP | C46H57N9O11S | Staphylococcus carnosus | AgrC | 14, 56 |
| 220 | YNPCLGFI, thiolacton linkage between C4 and I8 | Autoinducing peptide, AIP | C44H61N9O10S | Staphylococcus simulans | AgrC1 | 34 |
| 221 | IFW(Geranyl)EQ | [2–6]ComX RO-E-2 | C46H63N7O9 | Derived | ComP | 8 |
| 222 | GAFW(Geranyl)EQ | [I2A]ComX RO-E-2 | C45H60N8O10 | Derived | ComP | 8 |
| 223 | YSTCAbuFIM, thiolacton linkage between C4 and M8 | - | C43H62N8O11S2 | Derived | AgrC1, AgrC2 | 6 |
| 224 | YSTCSYYF, thiolacton linkage between C4 and F8 | Autoinducing peptide, AIP | C49H58N8O14S | Staphylococcus caprae | AgrC1 | 34 |
| 225 | ETIIIIGGG
| SHP1509, Short Hydrophobic Peptide | C39H69N9O13
| Streptococcus mutans | Rgg | 81 |
| 226 | DILIIVGG | SHP3, Short Hydrophobic Peptide 3 | C37H66N8O11
| Streptococcus agalactiae | Rgg | 23, 81 |
| 227 | DIIIIVGG | SHP2-C8 | C37H66N8O11 | Derived | Rgg | 23 |
| 228 | EIIIIVGG | - | C38H68N8O11 | Derived | Rgg | 23 |
| 229 | EGIIVIVVG | SHP1358(15-23) | C42H75N9O12 | Streptococcus thermophilus | Rgg1358 | 33 |
| 230 | AILPYFAGCL | SHP0316(18-24), ComS | C52H78N10O12S | Streptococcus thermophilus | ComR | 73 |
| 231 | GLDWWSL | ComS | C43H57N9O11 | Streptococcus mutans | ComR | 74 |
| 232 | DIFKLVIDHISMKARKK | SilCR | C93H160N26O23S | Streptococcus dysgalactiae | SilB | 78, 79 |
| 233 | SAVDWWRL | XIP | C49H69N13O12 | Streptococcus pyogenes | ComR | 78, 80 |
| 234 | EFDWWNLG | XIP | C52H63N11O14 | Streptococcus pyogenes | ComR | 78, 80 |
| 235 | DIIIIFPPFG | Short Hydrophobic Peptide;SHP1299 | C58H86N10O13 | Streptococcus thermophilus | Rgg | 81 |
| 236 | (D)INCDFLL, thiolacton linkage between C3 and L7 | AIP3 D-I1 | C38H58N8O10S1 | Derived | AgrC1, AgrC2, AgrC3, AgrC4 | 82 |
| 237 | I(D)NCDFLL, thiolacton linkage between C3 and L7 | AIP3 D-N2 | C38H58N8O10S | Derived | AgrC1, AgrC2, AgrC3, AgrC4 | 82 |
| 238 | RGQQNE | BsEDF | C27H46N12O12 | Bacillus subtilis | - | 83 |
| 239 | INEQTVVTK | PaEDF-1 | C44H78N12O16 | Pseudomonas aeruginosa | - | 83 |
| 240 | VEVSDDGSGGNTSLSQ | PaEDF-2 | C60H98N18O30 | Pseudomonas aeruginosa | - | 83 |
| 241 | APKLSDGAAAGYVTKA | PaEDF-3 | C67H110N18O22 | Pseudomonas aeruginosa | - | 83 |
| 242 | NFGAPGGAYPW | QSP1 | C55H69N13O14 | Cryptococcus neoformans | TUP1 | 84 |
| 243 | APAAEPAPSVKSQNFGAPGGAYPW | QSP24 | C113H158N28O32 | Cryptococcus neoformans | TUP1 | 84 |
| 244 | NFGAPGGASPI | QSP2 | C44H66N12O14 | Cryptococcus neoformans | TUP1 | 84 |
| 246 | GDSVCASYF, thiolacton linkage between C5 and F9 | - | C41H55N9O14S | Synthetic | AgrC | 85 |
| 247 | SVCASYF, thiolacton linkage between C3 and F7 | - | C35H47N7O10S | Synthetic | AgrC | 85 |
| 248 | SKADT | - | C20H36N6O10 | Synthetic | Cry1Aa | 94 |
| 249 | SKPAD | - | C25H38N6O8 | Synthetic | Cry1Aa | 94 |
| 250 | DSVSASYF, lacton linkage between S4 and F8 | - | C39H52N8O14 | Synthetic | AgrC | 85 |
| 251 | DSVDprASYF, lactam linkage between Dpr4 and F8 | - | C39H53N9O13 | Synthetic | AgrC | 85 |
| 252 | SKPDT | NprRB | C22H38N6O10 | Bacillus thuringiensis | Npr | 87 |
| 253 | ARGMT | - | C20H38N8O7S | Synthetic | - | 26 |
| 254 | ERNMT | - | C24H43N9O10S | Synthetic | - | 26 |
| 255 | ERGQT | - | C22H39N9O10 | Synthetic | - | 26 |
| 256 | ARNMT | - | C22H41N9O8S | Synthetic | - | 26 |
| 257 | ARGQT | - | C20H37N9O8 | Synthetic | - | 26 |
| 258 | ERNQT | - | C24H42N10O11 | Synthetic | - | 26 |
| 259 | ERAMT | - | C23H42N8O9S | Synthetic | / | 88 |
| 260 | AKPDT | - | C22H38N6O9 | Synthetic | Cry1Aa | 94 |
| 261 | NVWNK | - | C30H45N9O8 | Streptococcus pneumoniae | - | 89 |
| 262 | PLWCA | - | C28H40N6O6S | Eikenella corodens | - | 89 |
| 263 | NIWNR | - | C31H47N11O8 | Streptococcus gordonii | - | 89 |
| 264 | benzyloxycarbonyl-QNSAAAFAAWA, lacton linkage between S3 and A11 | - | C61H79N15O17 | Synthetic | Fsr | 90 |
| 265 | benzyloxycarbonyl-QNSAAAFAQWA, lacton linkage between S3 and A11 | - | C63H82N16O18 | Synthetic | Fsr | 90 |
| 266 | benzyloxycarbonyl-QNSANAFAAWA, lacton linkage between S3 and A11 | - | C62H80N16O18 | Synthetic | Fsr | 90 |
| 267 | benzyloxycarbonyl-QNSAAIFAAWA, lacton linkage between S3 and A11 | - | C64H85N15O17 | Synthetic | Fsr | 90 |
| 268 | benzyloxycarbonyl-QNSPAAFAAWA, lacton linkage between S3 and A11 | - | C63H81N15O17 | Synthetic | Fsr | 90 |
| 269 | benzyloxycarbonyl-QNSAAAFAAWM, lacton linkage between S3 and M11 | - | C63H83N15O17S | Synthetic | Fsr | 90 |
| 270 | benzyloxycarbonyl-QNSAAAFGAWA, lacton linkage between S3 and A11 | - | C60H77N15O17 | Synthetic | Fsr | 90 |
| 271 | benzyloxycarbonyl-QNSAAAFGAWM, lacton linkage between S3 and M11 | - | C62H81N15O17S | Synthetic | Fsr | 90 |
| 272 | benzyloxycarbonyl-QNSANAFGAWA, lacton linkage between S3 and A11 | - | C61H78N16O18 | Synthetic | Fsr | 90 |
| 273 | benzyloxycarbonyl-QNSAAAFGQWA, lacton linkage between S3 and A1 | - | C62H80N16O18 | Synthetic | Fsr | 90 |
| 274 | benzyloxycarbonyl-QNSAAIFGAWA, lacton linkage between S3 and A1 | - | C63H83N15O17 | Synthetic | Fsr | 90 |
| 275 | benzyloxycarbonyl-QNSPAAFGAWA, lacton linkage between S3 and A11 | - | C62H79N15O17 | Synthetic | Fsr | 90 |
| 276 | benzyloxycarbonyl-QNSPAAFGAWM, lacton linkage between S3 and M11 | - | C64H83N15O17S | Synthetic | Fsr | 90 |
| 277 | benzyloxycarbonyl-QNSPAAFGQWA, lacton linkage between S3 and A11 | - | C64H82N16O18 | Synthetic | Fsr | 90 |
| 278 | benzyloxycarbonyl-QNSPNAFGAWA, lacton linkage between S3 and A11 | - | C63H80N16O18 | Synthetic | Fsr | 90 |
| 279 | benzyloxycarbonyl-QNSPAIFGAWA, lacton linkage between S3 and A11 | - | C65H85N15O17 | Synthetic | Fsr | 90 |
| 280 | benzyloxycarbonyl-QNSPNIFGAWA, lacton linkage between S3 and A11 | - | C66H86N16O18 | Synthetic | Fsr | 90 |
| 281 | benzyloxycarbonyl-QNSPAIFGAWM, lacton linkage between S3 and M11 | - | C67H89N15O17S | Synthetic | Fsr | 90 |
| 282 | benzyloxycarbonyl-QNSPAIFGQWA, lacton linkage between S3 and A11 | - | C67H88N16O18 | Synthetic | Fsr | 90 |
| 283 | benzyloxycarbonyl-QNSPF(pentafluor)IFGAWA, lacton linkage between S3 and A11 | - | C71H84F5N15O17 | Synthetic | Fsr | 90 |
| 284 | benzyloxycarbonyl-QNSPWIFGAWA, lacton linkage between S3 and A11 | - | C73H90N16O17 | Synthetic | Fsr | 90 |
| 285 | benzyloxycarbonyl-QNSPD(Obzl)IFGAWA, lacton linkage between S3 and A11 | - | C73H91N15O19 | Synthetic | Fsr | 90 |
| 286 | benzyloxycarbonyl-QNSPY(2,6-Cl2-Bzl)IFGAWA, lacton linkage between S3 and A11 | - | C78H93Cl2N15O18 | Synthetic | Fsr | 90 |
| 287 | benzyloxycarbonyl-QNSPY(Bzl)IFGAWA, lacton linkage between S3 and A11 | - | C78H95N15O18 | Synthetic | Fsr | 90 |
| 288 | QNSPNIFGQF(D)M, lacton linkage between S3 and M11 | - | C57H81N15O16S | Synthetic | - | 91 |
| 289 | Ac-QNSPNIFGQWM, lacton linkage between S3 and M11 | - | C61H84N16O17S | Synthetic | - | 91 |
| 290 | PWASPSAARVFALGRDLPRAGCPLPQPS | TM0504 | C131H205N39O35S | Thermotoga maritima | - | 92 |
| 291 | YSTC(alpha-aminobutyric acid)FIM, thiolacton linkage between C4 and M8 | - | C43H62N8O11S2 | Synthetic | AgrC1, AgrC2 | 93 |
| 292 | N-4-(4-benzylphenoxy)butyryl-STCAFIM, thiolacton linkage between C4 and M8 | - | C50H67N7O11S2 | Synthetic | AgrC1, AgrC2 | 93 |
| 293 | N-4-(4-benzoylphenoxy)butyryl-STCAFIM, thiolacton linkage between C4 and M8 | - | C50H65N7O12S2 | Synthetic | AgrC1, AgrC2 | 93 |
| 294 | NASKYNPCSNYL, thiolacton linkage between C8 and L12 | AIP-II | C59H86N16O19S | Staphylococcus epidermidis | AgrC1, AgrC2, AgrC3 | 95 |
| 295 | NAAKYNPCASYL, thiolacton linkage between C8 and L12 | AIP-III | C58H85N15O17S | Staphylococcus epidermidis | AgrC1, AgrC2, AgrC3 | 95 |
| 296 | IMDILIIVGG | SHP2-C10 | C48H86N10O13S | Streptococcus pyogenes | Rgg | 96 |
| 297 | MDILIIVGG | SHP2-C9 | C42H75N9O12S | Streptococcus pyogenes | Rgg | 96 |
| 298 | ILIIVGG | SHP2-C7 | C33H61N7O8 | Streptococcus pyogenes | Rgg | 96 |
| 299 | AMDIIIIVGG | SHP3-C10 | C45H80N10O13S | Streptococcus pyogenes | Rgg | 96 |
| 300 | MDIIIIVGG | SHP3-C9 | C42H75N9O12S | Streptococcus pyogenes | Rgg | 96 |
| 301 | IIIIVGG | SHP3-C7 | C33H61N7O8 | Streptococcus pyogenes | Rgg | 96 |
| 302 | KW(farnesyl)PPIE | ComX natto | C53H80N8O9 | Bacillus subtilis | ComP | 97 |
| 303 | WKAE(Dha)VA(Abu)PGAV(Abu)GLLQ(Abu)AFLQ(Abu)I(Abu)ANAKI(Dha)K, cyclisation between (Ala3-S-Ala7), (Abu8-S-Ala11), (Abu13-S-Ala19), (Abu23-S-Ala26) and (Abu25-S-Ala28) | Entianin | C150H231N39O39S5 | Bacillus subtilis | SpaK | 98 |
| 304 | CFMFV, thiolacton linkage between C1 and V5 | AIP | C31H41N5O5S2 | Listeria monocytogenes | AgrC | 99 |
| 305 | SFFIF, lacton linkage between S1 and F5 | AgrD | C36H43N5O6 | Clostridium thermocellum | / | 100 |
| 306 | LDWWSLG | EBS1 XIP | C44H59N9O11 | Derived | ComR | 101 |
| 307 | TGWWMLG | EBS2 XIP | C41H56N10O9S | Derived | ComR | 101 |
| 308 | ETEWWNVG | EBS3 XIP | C47H61N11O15 | Derived | ComR | 101 |
| 309 | CLWFT | - | C33H44N6O7S | Derived | / | 103 |
| 310 | CLWFT, thiolacton linkage between C1 and T5 | - | C33H42N6O6S | Derived | / | 103 |
| 311 | SLWFT | - | C33H44N6O8 | Derived | / | 103 |
| 312 | SLWFT, lacton linkage between S1 and T5 | - | C33H42N6O7 | Derived | / | 103 |
| 313 | TSACLWFT, thiolacton linkage between C4 and T8 | AgrDCp | C43H59N9O11S | Clostridium perfringens | / | 102, 103 |
| 314 | CLWFTH, thiolacton linkage between C1 and H6 | - | C39H49N9O7S | Derived | / | 103 |
| 315 | TYLFTNS, lacton linkage between T1 and S7, modified at T1 and Y2 | WS9326A | C54H68N8O13 | Clostridium perfringens | VirSR | 104 |
| 316 | TYLFTNS, lacton linkage between T1 and S7, modified at T1 | WS9326B | C54H70N8O13 | Clostridium perfringens | VirSR | 104 |
| 317 | PFTFAFF, lacton linkage between T3 and F7, modified at P1, F6, F7 | Cochinmicin II/III | C46H46ClN7O12 | Clostridium perfringens | VirSR | 104 |
| 318 | INCAFLL, thiolacton linkage between C3 and L7 | AIP3 D4A | C37H58N8O8S | Derived | AgrC1, AgrC2, AgrC3, AgrC4 | 82 |
| 319 | IACDFLL, thiolacton linkage between C3 and L7 | AIP3 N2A | C37H57N7O9S | Derived | AgrC1, AgrC2, AgrC4 | 82 |
| 320 | ANCDFLL, thiolacton linkage between C3 and L7 | AIP3 I1A | C35H52N8O10S | Derived | AgrC1, AgrC2, AgrC3, AgrC4 | 82 |
| 321 | INCDFL(D)L, thiolacton linkage between C3 and L7 | AIP3 D-L7 | C38H58N8O10S | Derived | AgrC1, AgrC2, AgrC4 | 82 |
| 322 | INDapAFLL, amide linkage between Dap3 and L7 | AIP3 D4A amide | C37H59N9O8 | Derived | AgrC1, AgrC2, AgrC3, AgrC4 | 105 |
| 323 | Ac-DapAFLL, amide linkage between Dap1 and L5 | tAIP3 D2A amide | C29H44N6O6 | Derived | AgrC1, AgrC2, AgrC3, AgrC4 | 105 |
| 324 | Ac-CNAYF, thiolacton linkage between C1 and F5 | - | C30H36N6O8S | Derived | AgrC1 | 106 |
| 325 | Ac-CNGYF, thiolacton linkage between C1 and F5 | - | C29H34N6O8S | Derived | AgrC1 | 106 |
| 326 | Ac-CASYF, thiolacton linkage between C1 and F5 | - | C29H35N5O8S | Derived | AgrC1 | 106 |
| 327 | Ac-CN(trityl)AY(tBu)F, thiolacton linkage between C1 and F5 | - | C53H58N6O8S | Derived | AgrC1 | 106 |
| 328 | Ac-CN(trityl)GY(tBu)F, thiolacton linkage between C1 and F5 | - | C52H56N6O8S | Derived | AgrC1 | 106 |
| 329 | ASVCASYF, thiolacton linkage between C4 and F8 | - | C38H52N8O11S | Derived | AgrC1 | 107 |
| 330 | DSACASYF, thiolacton linkage between C4 and F8 | - | C37H48N8O13S | Derived | AgrC1 | 107 |
| 332 | D(D)SVCASYF, thiolacton linkage between C4 and F8 | - | C39H52N8O13S | Derived | AgrC1 | 107 |
| 333 | DAVCASYF, thiolacton linkage between C4 and F8 | - | C39H52N8O12S | Derived | AgrC1 | 107 |
| 334 | DSVCAAYF, thiolacton linkage between C4 and F8 | - | C39H52N8O12S | Derived | AgrC1 | 107 |
| 335 | (D)DSVCASYF, thiolacton linkage between C4 and F8 | - | C39H52N8O13S | Derived | AgrC1 | 107 |
| 336 | DS(D)VCASYF, thiolacton linkage between C4 and F8 | - | C39H52N8O13S | Derived | AgrC1 | 107 |
| 337 | DSVCA(D)SYF, thiolacton linkage between C4 and F8 | - | C39H52N8O13S | Derived | AgrC1 | 107 |
| 338 | DSVCASY(D)F, thiolacton linkage between C4 and F8 | - | C39H52N8O13S | Derived | AgrC1 | 107 |
| 339 | DSVCYSYF, thiolacton linkage between C4 and F8 | - | C45H56N8O14S | Derived | AgrC1 | 107 |
| 340 | DSVCSSYF, thiolacton linkage between C4 and F8 | - | C39H52N8O14S | Derived | AgrC1 | 107 |
| 341 | DSACYSYF, thiolacton linkage between C4 and F8 | - | C43H52N8O14S | Derived | AgrC1 | 107 |
| 342 | DSACSSYF, thiolacton linkage between C4 and F8 | - | C37H48N8O14S | Derived | AgrC1 | 107 |
| 343 | ASVCAAYF , thiolacton linkage between C4 and F8 | - | C38H52N8O10S | Derived | AgrC1 | 107 |
| 344 | ASACAAYF, thiolacton linkage between C4 and F8 | - | C36H48N8O10S | Derived | AgrC1, AgrC2, AgrC3 | 107 |
| 345 | ASACSAYF, thiolacton linkage between C4 and F8 | - | C36H48N8O11S | Derived | AgrC1, AgrC2, AgrC3 | 107 |
| 346 | ASKYNPCSNYL, thiolacton linkage between C7 and L11 | - | C55H80N14O17S | Derived | AgrC1 | 107 |
| 347 | SKYNPCSNYL, thiolacton linkage between C6 and L10 | - | C52H75N13O16S | Derived | AgrC1 | 107 |
| 348 | NPCSNYL, thiolacton linkage between C3 and L7 | - | C34H49N9O11S | Derived | AgrC1 | 107 |
| 349 | Ac-CSNYL, thiolacton linkage between C1 and L5 | - | C27H38N6O9S | Derived | AgrC1 | 107 |
| 350 | SAIRGA | Arbitrium | C23H43N9O8 | Phage-produced | AimR | 108 |
| 351 | GMPRGA | - | C23H41N9O7S | Derived | AimR | 108 |
| 352 | SNGLDVGKAD | PhrA | C39H66N12O17 | Synthetic | TprA | 109 |
| 353 | SKPDIVG | NprX | C31H54N8O11 | Bacillus cereus | NprR | 110 |