Quorumpeps Results


Search hits: 5
ID This field contains the IDs of the molecules listed. If you wish to see more details regarding a molecule, please click its ID. SequenceTrivial nameMolecular formulaSpecies originReceptorReference This field contains the IDs of the related publications for every molecule. If you wish to see more details regarding a related publication, please click its ID.
58DSRIRMGFDFSKLFGKCSP, Competence Stimulating PeptideC86H134N24O23SStreptococcus constellatus, Streptococcus anginosus, Streptococcus thermophilusComD57, 58, 59
183SGWMDYINGFLKGFGGQRTLPTKDYNIPQVSTPC156H233N40O44S1Streptococcus thermophilusStbH29
229EGIIVIVVGSHP1358(15-23)C42H75N9O12Streptococcus thermophilusRgg135833
230AILPYFAGCLSHP0316(18-24), ComSC52H78N10O12SStreptococcus thermophilusComR73
235DIIIIFPPFGShort Hydrophobic Peptide;SHP1299 C58H86N10O13Streptococcus thermophilusRgg81